KEGG   Saccharomyces cerevisiae (budding yeast): YJR088CHelp
Entry
YJR088C           CDS       T00005                                 

Gene name
EMC2
Definition
(RefSeq) Emc2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_6 Cucumopine_C TPR_7 Ribosomal_L10 TPR_8 TPR_11 TPR_9
Motif
Other DBs
NCBI-GeneID: 853550
NCBI-ProteinID: NP_012621
SGD: S000003848
UniProt: P47133
Position
X:complement(586495..587373)
Genome map
AA seq 292 aa AA seqDB search
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggatttggttagagaaaagcttttgacaattatgaataccaaagcgtatact
caatttaatccagaacaattactgcaactagaaaatgaaatgaaaatttacatgaaaagc
ggagactctgcactaacagaaggaaactatttcttcttgatggaaatgcttttctatgtt
ttggtgtaccgaaaccaagacgttgatgcgcaagttgtttataatacattaagagatcgt
cttggtgaaaattcgtataaaatggtaatcatgaaagccactttattgcagataaacgga
aatgataaaggcgctattgaatatctggaaaatttgttgaatgatgatctggagtatgaa
acggacttcgttacttatgtctctattgcaaagaaattgatagctatcaagacaacttcc
aagaacttgagccaagaaagtgttcttaaagaagtggtagctcttacagataaattcccg
cttgatgcagaattgtggtggtatgccagcgagatttatttcgaaatgggccaatttgaa
aaagcctgttattgtttggaacaggtcctatgtattacaccattcaattacgcttgtttt
ggtaggctaagtgagactctgtattatgaggctctacgtagcaagaaacaaaccaagacc
gagctcttggaaaaggcattaaagaatgctttgaggagcgttgaacttagcgaactatac
ctaaaagggtgggcattggttaacatcatttctcgcgaactgggacgtaataaacaaaat
gacttgatcaaactatctgcatcgaagctaaaggaaatttctgcgaagtctaacaataaa
gataagattaccgctgaattaattttgaataagatatga

DBGET integrated database retrieval system