KEGG   Saccharomyces cerevisiae (budding yeast): YJR095W
Entry
YJR095W           CDS       T00005                                 

Gene name
SFC1, ACR1
Definition
(RefSeq) Sfc1p
  KO
K15100  solute carrier family 25 (mitochondrial citrate transporter), member 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJR095W (SFC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YJR095W (SFC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 853558
NCBI-ProteinID: NP_012629
SGD: S000003856
UniProt: P33303
Position
X:609773..610741
AA seq 322 aa
MSQKKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGR
TIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGA
GITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSL
TAARQATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKT
RLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYV
REHLENLGIFKKNDTPKPKPLK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgtctcaaaaaaagaaggcttcccatccagccatcaatctcatggctggcggcacagca
ggtttatttgaagcattgtgttgtcatcctttagatacaattaaggtgagaatgcaaata
tacagacgggtagctggtattgaacatgttaaacccccaggatttattaaaactgggcgt
accatttatcaaaaagaaggtttcttggctctgtataaaggtctaggtgctgtggtcatc
ggtattatacctaagatggcaatccgtttctcgtcttatgaattctatagaaccttattg
gttaacaaggaatcaggaattgtgtctaccggtaatacttttgttgctggtgttggggct
ggtatcaccgaagctgttcttgtcgtgaacccgatggaagttgtaaagattaggttacaa
gctcagcatttaactccgagtgagccaaatgctggtcctaaatataacaacgccattcat
gcagcctacactattgtcaaagaagaaggtgtttctgccttatatagaggcgtttcctta
actgcggcaaggcaagcaactaatcagggtgctaacttcacagtttattctaaactgaag
gagtttttgcagaattaccatcagatggatgtcctaccttcatgggaaacttcttgcata
ggtttgatttcgggtgctattgggccgttttccaacgctccattggatactataaagaca
aggctgcaaaaggataagtccatctcattggaaaaacagtccggtatgaagaaaatcata
accattggtgctcaactactgaaagaagaaggttttagagctttgtacaagggtattacc
ccaagagtgatgagggtggctccaggtcaggctgtcacctttaccgtttatgaatatgta
agggagcatttagaaaatttgggtatattcaagaagaatgacacaccaaagccaaagcca
ttaaagtag

DBGET integrated database retrieval system