KEGG   Saccharomyces cerevisiae (budding yeast): YJR111CHelp
Entry
YJR111C           CDS       T00005                                 

Gene name
PXP2
Definition
(RefSeq) Pxp2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-GeneID: 853575
NCBI-ProteinID: NP_012645
SGD: S000003872
UniProt: P47148
Position
X:complement(635855..636706)
Genome map
AA seq 283 aa AA seqDB search
MNQILNAQRLIQLSQFHPKLKNIWYLVAAATFSVCNEPQEIPKLYHYAMLLSNDNAHMYR
FTLASQTIDLLRSELPMRKTLINENYQQPTFFQKQLTAKFREVILKTGPLAGLPRAINGL
TMLKETTPDILVPHLDPIDPWEAAMGNSSPLSETSMRRKHDKTIQERDHTIQNGLRHWNS
IYNKVSTRVVNNLNSSYPDLWYYTLVHVYGPLFAFDEILSAQETSLVIIASLVPQDVNPQ
LRGHLKGALNIGCDKETVEAVRGLAILISQWCGVSWKSGVVKL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatactaaatgcacaaaggctgatacaattatcacaatttcaccctaaactg
aagaatatatggtaccttgttgcggccgccacgttcagtgtttgtaatgagccacaggaa
atacctaaattataccactatgccatgctactgagtaatgataatgcacacatgtataga
ttcacattagcttcccaaaccattgacttactgcgctcagaattaccaatgagaaaaact
ttgatcaatgagaattaccaacaacctacttttttccaaaagcaattgacagcaaaattt
agagaagttattcttaaaacaggacctctggccggccttccaagagcgatcaatggcctg
actatgctaaaggaaactactccggacattttagtaccgcacttagacccaatagacccg
tgggaggctgccatgggaaacagttctcccctttcggaaacctctatgagaaggaagcat
gacaagacaatccaggaaagagatcataccatacagaacggcttacggcattggaattca
atatacaacaaagtctcaacccgcgtggtaaacaatctaaactcttcgtacccagactta
tggtattatacactggtccatgtatatggccctttgtttgcctttgatgagatactatct
gcgcaagagacaagtttagtgataattgcttctttggttccacaagatgttaatcctcaa
ttgcgtgggcatttgaaaggtgccttgaatattggttgtgataaggaaactgtggaggca
gtgagaggattggctatactaatatctcagtggtgtggtgttagttggaaatctggtgtt
gtaaaattgtaa

DBGET integrated database retrieval system