KEGG   Saccharomyces cerevisiae (budding yeast): YJR112WHelp
Entry
YJR112W           CDS       T00005                                 

Gene name
NNF1
Definition
(RefSeq) MIND complex subunit NNF1
  KO
K11562  kinetochore protein NNF1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR112W (NNF1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    NMS complex
     MIND kinetochore complex
      YJR112W (NNF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nnf1 DUF5499 DUF4795 V-SNARE
Motif
Other DBs
NCBI-GeneID: 853576
NCBI-ProteinID: NP_012646
SGD: S000003873
UniProt: P47149
Position
X:637030..637635
Genome map
AA seq 201 aa AA seqDB search
MVNSHGIRYIRLKQVFNRALDQSISKLQSWDKVSSCFPQYVNSKQGAINVANCQRQLTEF
WTELCQREFKEIMEERNVEQKLNELDELILEAKERYTDRDQDEVNKGPAIDELSSKELVE
CHLYSQRMHAIHEIDERLAKVNEMNDQLAQELKDLETQVEVEKNEIGKMYDEYLGSHTDQ
PANVLLVQSLNDMVLELKENY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggttaactcacatggaatacggtatattcggttgaagcaggtctttaatcgtgcattg
gaccaatcgatttcgaaattacagagttgggacaaggtcagttcatgcttcccgcaatat
gtgaatagcaagcagggcgctataaacgtcgccaattgtcagcgccaattaacggaattc
tggacggagctttgtcaacgagagtttaaagaaattatggaagaacgaaacgtcgagcag
aaactaaatgagttggacgaactgattttggaggctaaagaacgttacacggatcgtgat
caagatgaagtaaacaaagggcccgcgatcgatgagctctccagcaaagagcttgtggaa
tgccatttatacagccaacggatgcatgccatacacgagatagacgagcggcttgcgaaa
gtgaatgagatgaacgaccagttagcccaggagttgaaagacttagagacgcaagtagag
gtagagaaaaacgaaattggcaagatgtacgatgagtacctgggctcccacacggaccaa
ccggccaacgtgctgctggtacagagcctcaatgatatggtcttggaattgaaggaaaac
tattga

DBGET integrated database retrieval system