KEGG   Saccharomyces cerevisiae (budding yeast): YJR113CHelp
Entry
YJR113C           CDS       T00005                                 

Gene name
RSM7
Definition
(RefSeq) mitochondrial 37S ribosomal protein RSM7
  KO
K02992  small subunit ribosomal protein S7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YJR113C (RSM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YJR113C (RSM7)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    YJR113C (RSM7)
  Bacteria
    YJR113C (RSM7)
  Archaea
    YJR113C (RSM7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7
Motif
Other DBs
NCBI-GeneID: 853578
NCBI-ProteinID: NP_012647
SGD: S000003874
UniProt: P47150
Position
X:complement(638232..638975)
Genome map
AA seq 247 aa AA seqDB search
MLHCARRYMLVRPRLLWQSGTCVARFQSSVRTPASEPSAEKGVDEWLEAINELREEFSAK
EYLPETSLAPPGQSKVDLLQGSQAGSKIKPTAEQLAQWEALKSVPIPPRKNATLDHITNM
IMRHGKKEKAQTILSRALYLVYCQTRQDPIQALEKSLDELAPLMMTKTFNTGVAKASVIP
VPLNKRQRNRIAWNWIVQSANQRVSSDFAVRLGEELTAIAKGTSSAFEKRDQIHKTAIAH
RAYIQLK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctgcattgtgcgaggaggtatatgttagtcaggccacgtctcctgtggcaaagtggg
acatgtgttgctcgtttccagtcgtcagtacgaacaccagctagcgaaccatcggcagag
aaaggggtcgacgagtggcttgaagcgatcaacgagctaagggaagagttctctgcaaaa
gaatacctgccagagacctcgctggctccaccgggccagtccaaagtagacctcttacag
ggttcacaggcgggctccaagataaagccaactgcagagcagttggcacaatgggaggca
ctgaagtccgtgcccattcctccacgcaagaacgcaacgctggatcacatcacaaacatg
atcatgcgccacggtaagaaggaaaaggcacaaaccattctgtccagggccttatatctg
gtgtactgccagacccggcaggaccccatccaggctttggaaaagtcactcgacgaacta
gctccgctgatgatgaccaagacattcaacacaggcgtggccaaggcttctgtcattcct
gtgcctctgaacaagaggcaaagaaataggatcgcgtggaactggatcgtacaaagcgca
aaccaaagagtgtcgagcgacttcgccgtgcgtttgggagaagaactcactgccattgcc
aaaggcacttcgtctgcctttgaaaagagggaccagattcacaagacagccattgctcac
agagcatatattcaattaaagtaa

DBGET integrated database retrieval system