KEGG   Saccharomyces cerevisiae (budding yeast): YJR118CHelp
Entry
YJR118C           CDS       T00005                                 

Gene name
ILM1
Definition
(RefSeq) Ilm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ilm1
Motif
Other DBs
NCBI-GeneID: 853582
NCBI-ProteinID: NP_012652
SGD: S000003879
UniProt: P47155
Position
X:complement(643490..644101)
Genome map
AA seq 203 aa AA seqDB search
MAQALNSTNIAFFRVAFLFTIAFFCLKNVNSILQNTYFIVLTQAMNLPQLTLSRYSGQLG
LFALLFTLNGVHDLIPLLENNVKYFQSVVPVRLLIFFILTSISYLWESNFYVHNNSVFIY
CFAEVWINFLLYNAIREEKNEEFKRLNQFMVNDEDIEEPQPFTVKTETTEIIEIINDEEN
DDEDGKDNDDNNEKGNDDSDAKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagccttgaactccaccaatattgcttttttcagagtagcatttttattcacg
atcgccttcttttgtttaaagaacgttaattctattttgcaaaatacatatttcatagtc
ttaacgcaagcgatgaatttaccgcagttaacactgtcacgttatagtggtcaattgggt
cttttcgctcttctgtttactcttaacggtgttcatgatctaattcccctgttagaaaac
aatgttaaatacttccaatctgttgtgccagttagattactaattttttttattttgaca
agtatctcgtacctttgggagtcaaacttttacgttcacaataactctgtttttatttac
tgttttgcagaagtttggataaattttcttttgtataatgccattagggaggagaaaaat
gaagagttcaaaagattgaaccaattcatggttaatgatgaggatattgaagaaccccaa
ccatttaccgtgaagactgaaaccacagaaatcattgaaataatcaatgatgaagaaaat
gacgatgaagatgggaaagataatgatgataacaatgagaaaggtaatgatgatagcgat
gcaaaaaaataa

DBGET integrated database retrieval system