KEGG   Saccharomyces cerevisiae (budding yeast): YJR121WHelp
Entry
YJR121W           CDS       T00005                                 

Gene name
ATP2
Definition
(RefSeq) F1F0 ATP synthase subunit beta
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Module
sce_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YJR121W (ATP2)
Enzymes [BR:sce01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     YJR121W (ATP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase NB-ARC T3SS_ATPase_C AAA NACHT RsgA_GTPase AAA_16 RNA_helicase RnfC_N AAA_19
Motif
Other DBs
NCBI-GeneID: 853585
NCBI-ProteinID: NP_012655
SGD: S000003882
UniProt: P00830
Structure
PDB: 

Position
X:647607..649142
Genome map
AA seq 511 aa AA seqDB search
MVLPRLYTATSRAAFKAAKQSAPLLSTSWKRCMASAAQSTPITGKVTAVIGAIVDVHFEQ
SELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPV
GRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPY
ARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVI
NLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSE
VSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFA
HLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDI
IAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEG
KYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggttttgccaagactatatactgctacatcccgtgctgcttttaaagcagccaaacaa
tccgctccgcttctatccacttcgtggaaaagatgtatggcctcagctgctcaatctact
ccaatcaccggtaaagttaccgctgtcattggtgccattgttgacgttcattttgaacaa
tcagagttgcccgctattttgaacgctttagaaattaaaacacctcaaggtaagttggtt
ttggaagttgctcaacatttgggtgaaaacactgtcagaaccattgctatggatggtacc
gaaggtttggtccgtggtgaaaaggttcttgacactggtggccctatctccgtcccagtt
gggagagaaactttagggagaatcatcaacgttatcggtgaacctattgatgaaagaggt
ccaattaagtccaaactaagaaagccaattcacgcagaccctcctagttttgcagaacaa
tctacttcggctgaaattttggaaacaggtatcaaagtcgtcgatctattagctccttat
gccagaggtggtaagattggtcttttcggtggtgcaggtgtcggtaagactgtgttcatt
caagaattgattaacaatatcgccaaggcccatggtggtttttccgttttcaccggtgtt
ggtgaaagaacaagagaaggtaatgacttgtaccgtgaaatgaaggaaactggtgtcatt
aacttggaaggtgaatccaaggtcgccttagtgttcggtcaaatgaacgaacctccagga
gccagagccagagtcgctttaactggtttgacgatcgctgaatatttcagagatgaagaa
ggtcaagatgtcttgttgtttatcgacaatatctttagatttactcaagctggttcagaa
gtctctgcccttttgggtcgtattccatctgccgtcggttatcaaccaactttggccact
gatatgggtctcttacaagaaagaattaccaccacaaagaagggttctgtcacttctgtg
caagccgtttatgttccagccgatgatttaacagatcctgctcctgccactacttttgcc
catttggacgctactaccgtcttgtcaagaggtatttcagaattaggtatttaccctgca
gtggatccattggattctaaatcaaggttattggatgccgccgttgtcggtcaagaacat
tatgacgtcgcctccaaggttcaagaaactttacagacctataaatctttacaagatatc
attgctattttgggtatggatgaattgtccgaacaagataaactaactgtcgaaagggca
agaaagattcaaagattcttatctcaaccatttgctgtcgccgaagtctttactggtatc
ccaggtaaattagtgagattaaaggacaccgttgcctcgttcaaagccgttttggaaggt
aaatacgataatataccagaacatgctttctatatggttggtggtattgaagatgttgtt
gctaaagctgaaaagttagccgctgaagccaactag

DBGET integrated database retrieval system