KEGG   Saccharomyces cerevisiae (budding yeast): YJR123WHelp
Entry
YJR123W           CDS       T00005                                 

Gene name
RPS5
Definition
(RefSeq) ribosomal 40S subunit protein S5
  KO
K02989  small subunit ribosomal protein S5e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YJR123W (RPS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YJR123W (RPS5)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YJR123W (RPS5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7
Motif
Other DBs
NCBI-GeneID: 853587
NCBI-ProteinID: NP_012657
SGD: S000003884
UniProt: P26783
Structure
PDB: 

Position
X:651901..652578
Genome map
AA seq 225 aa AA seqDB search
MSDTEAPVEVQEDFEVVEEFTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVD
YVQVRQPIFVAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLDI
INVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVNQAIALLTIGAR
EAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELERVAKSNR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgaagctccagttgaagttcaagaagatttcgaagttgttgaagaattc
accccagtcgtcttggctactccaattccagaagaagtccaacaagctcaaaccgagatt
aagttgttcaacaaatggtcttttgaagaagttgaagttaaggatgcttctttggttgac
tacgttcaagttagacaaccaatctttgttgctcacaccgctggtcgttacgccaacaag
agattcagaaaggctcaatgtccaatcattgaaagattgaccaactccttgatgatgaac
ggtagaaacaacggtaagaaattaaaggctgttagaatcatcaagcacactttggacatc
atcaatgtcttgactgaccaaaacccaatccaagttgttgttgacgctatcaccaacact
ggtccaagagaagacaccaccagagtcggtggtggtggtgctgctagacgtcaagctgtc
gatgtttctccattgagaagagttaaccaagctattgctttgttgaccattggtgccaga
gaagctgctttcagaaacatcaagaccattgctgaaactttggccgaagaattgatcaat
gctgctaagggttcctctacttcttacgctatcaagaagaaggatgaattggaacgtgtt
gccaagtctaaccgttaa

DBGET integrated database retrieval system