KEGG   Saccharomyces cerevisiae (budding yeast): YJR124C
Entry
YJR124C           CDS       T00005                                 

Name
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1 MFS_1_like OATP Sugar_tr MFS_2
Other DBs
NCBI-GeneID: 853588
NCBI-ProteinID: NP_012658
SGD: S000003885
UniProt: P47159
Position
X:complement(652892..654238)
AA seq 448 aa
MAPEIFVKFKCASRDIKLLWASVFLRLLSYGLTNQVLTLFLNAINMTEDKIGLFMSLTLA
GDVICSYILTWYADSWGRRRVLVYGCAMMLLSGLVFSFSENFTLLLVFAIFGVISPSSDE
VGPFKSIEEAMIAHLSPHNARPEIYAIHALVGTIGSALGAIICGIFVDLLKRTGLAATDL
QCYKLVFLLYAFFAFCKMVIMLLLSDATELDGHYEHTDCNEETAEPLDVNDETAPLMRQA
THPEERSNKLSKETVSVLMKLLVIFMVDSLGSGFMTSGWMVYYYSKQFLMGSLALGTLFF
ITQLVMASSTIPSSIIARCFGPVRATLLVQIPSGIFSILIPMAKNYLPLSILFLNLHFAT
TAMDVTPRQILLTNIIKPRDLTKVMGVVNIGKTFARCVGPIFTGILANNNYLWLCYIISG
SLVITADLILACMFLGVDAKIKKQMNRH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggcaccggaaatttttgttaaattcaagtgtgcaagtagagacataaagctactatgg
gcgtccgtctttcttagacttctatcatatggtttaacaaatcaagttttgacgcttttt
ttaaatgccatcaatatgacagaggataaaattgggctgtttatgtcattaacactggca
ggggatgtaatttgctcttacattcttacttggtatgcggattcctggggccgaagaaga
gtcctagtttatggttgtgcaatgatgttgttaagtgggttggttttcagttttagcgaa
aatttcaccctcttgctagtatttgctatcttcggtgttatatcgccttcaagtgatgaa
gtcgggcctttcaaatctatagaagaggccatgattgcacatctgagtcctcataatgca
agaccagagatttatgctattcacgccttggttggaacaattggaagcgctctaggtgca
ataatttgtggtatatttgtagatcttttgaaaagaactggtttagctgctactgatttg
caatgttataaattagttttcttactgtatgccttcttcgccttttgcaaaatggtcatc
atgctcttattatcagatgctacagaattggacgggcattatgaacatacagattgcaat
gaagaaacagctgaaccattggacgttaacgatgaaactgcaccattaatgagacaagca
actcacccagaagaaagatccaacaaactatctaaggagaccgtttcggttttgatgaaa
ttgttagtaatcttcatggtcgactctctcgggtccgggtttatgacaagtggctggatg
gtttactactatagtaagcaatttttgatgggatctctggcgttgggtactttatttttc
atcacgcaactggttatggcatcttccaccatcccatcatcaataattgccagatgtttt
ggcccagtaagagccacactattggtccaaattccatcagggatattttctattctcatc
cctatggccaagaattacttgcccttatctattttgtttttgaatctgcattttgcaaca
actgccatggacgttacaccaaggcaaattctattaacaaatatcatcaaaccaagagat
ttaaccaaagttatgggggtggtcaacattggaaagacatttgctcggtgtgttggtcca
atattcacgggtatacttgctaacaataattatttatggctatgttacatcattagtggg
tccttggtgataacggcggatctaatactggcatgcatgtttttaggagtggacgctaaa
attaaaaagcaaatgaaccgccattaa

DBGET integrated database retrieval system