KEGG   Saccharomyces cerevisiae (budding yeast): YJR126C
Entry
YJR126C           CDS       T00005                                 

Gene name
VPS70
Definition
(RefSeq) putative zinc metalloprotease
  KO
K01301  N-acetylated-alpha-linked acidic dipeptidase [EC:3.4.17.21]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YJR126C (VPS70)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     YJR126C (VPS70)
Peptidases and inhibitors [BR:sce01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   YJR126C (VPS70)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA T4SS-DNA_transf
Other DBs
NCBI-GeneID: 853590
NCBI-ProteinID: NP_012660
SGD: S000003887
UniProt: P47161
Position
X:complement(656254..658689)
AA seq 811 aa
MRMIQRERKREKEEGQLKERTVVNMADPDDNEAEATGLQQYSGETTRDDNEESMNDSFTL
TSRNRGRSNTISSIVSGYEIMKEHMDKEKFMYLILASLLLYMGFVAAFAPRTSLSRDFRR
FHSSRLTNAEVYRIYLNSLQQENRAKEHVYKYAGYMSNGASDSSTFKYTLDEFLDMGYKP
KVEKYYPWIGEPVDTNVAPLENGKVVYEASMIEDRVKGDPASHARKRQKGFHQYSKNGSV
TARYVFCNYGSISDYKLLLKKNIDIEDKIHIVRSGKILPGLKVKNAELYGASSVIIYTDP
FDDGKVTEENGFLHYPYGPARNPSYIRRDSVNYFSDTPGDPTTPGYPSKDSDTEHMSPVG
RVPRIPSVPMSARDVQPILERLNGRGFQIGPGSNIKDFGSFTGPSSSIDKVHLHNELTYN
IKEMSSVEVSIPGIFTEGEIIIGAHRDSLASSSAGDANSGSAILLEIARGMSKLLKHGWK
PLRPIKLISWDGERSGLLGSTDYAEAHAAILRRRALVYLNLDNAISGTNFHCKANPLLQD
VIYEAAKLTEFNGHEDWSLFDHWKYTSNATISLLDGLSSYTSFQYHLGVPAAHFQFNAND
TSGAVYHSNSVFDSPTWLEKFTNSDYKLHNTMAMFVGLTTLMLSENELARFNTHVYLKKI
YNWYIAWHSNLSSAFPQDDEVNSLAKRVLDLLKVATQEDSIQFDQQNGILYKECREALPV
WAFYKKIKSYIKLQRSNSKSKQIDQLFITHRGLKDREWMKYSLLAPSKFEGSVGEVLPGL
HEGLADIDRNEVIQWLTILLSQFSNVRYLLQ
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgagaatgatacagagagagagaaagagagagaaagaggaaggtcaattaaaggagaga
actgttgttaatatggcagaccctgatgacaatgaggccgaagccactggattacaacaa
tatagtggcgagaccactcgcgatgacaatgaagaaagcatgaatgattctttcacttta
acatccaggaatagaggcagaagtaatacaatatctagtattgttagtggttatgaaata
atgaaagaacatatggacaaggaaaagtttatgtacttgattctagcgagtctccttttg
tacatgggatttgttgccgcatttgctcccaggacgtctttatcaagagactttcggcgg
tttcactcttccagattgacgaatgcagaggtttataggatatacttgaactccttgcaa
caggaaaatagagcgaaagaacatgtatacaagtatgctgggtacatgagcaacggagca
agtgattcgtcaacgtttaaatataccttggacgagtttctagatatggggtacaaaccc
aaagttgaaaaatattacccatggataggtgaaccagtagacactaacgtagctccttta
gaaaatggtaaagtggtctacgaagcaagcatgatcgaggatagagttaaaggtgatcct
gcttctcacgctaggaaaaggcaaaagggtttccatcaatattcaaaaaatggaagtgta
actgctcgatacgtgttttgcaattatggtagcatcagtgattacaagctacttttgaag
aaaaacattgatattgaagataaaatccacatcgtacgatcgggtaaaatattacctgga
ttaaaggtaaagaatgcagaactttatggcgcttccagtgtcattatatatacagaccca
tttgacgatggtaaagttactgaggaaaatgggtttttacactatccttatggaccagca
agaaacccaagttatattaggagagattctgtaaactatttcagtgacactccaggagat
ccgacaactccagggtatccctccaaggattccgacactgaacatatgtcaccggtaggg
agagtgccgaggataccatcggtgccgatgagtgctagagatgtccaaccaattttagaa
agattgaatggcaggggttttcaaattgggcccggtagtaatataaaagattttggatca
ttcactggaccttcaagctctatcgataaagtccatttgcataatgagctaacttacaac
atcaaggaaatgagtagtgtagaggttagtatccctggtatattcactgagggggagatt
attatcggagctcatagggattcgctcgcctcgagtagcgccggtgatgcaaatagtggc
agcgctattcttttagaaattgcacgaggaatgagtaaattacttaagcatggttggaag
ccactgcgtcctatcaaactaataagttgggatggtgaacgatccggccttctgggatct
acagattatgcagaagctcatgctgcgattctcaggagaagggccttggtatacctaaat
ctagataatgcaatctctgggacaaattttcactgtaaagccaacccacttttacaagac
gtgatatacgaagctgctaagctcacggaatttaatgggcacgaagactggtcattgttc
gaccattggaaatacacttctaatgccactatttctctacttgatgggttgtctagttac
acttcatttcagtaccatcttggagtgcccgctgcacattttcagtttaatgccaatgat
acttcaggcgcagtctatcatagtaactccgtattcgatagcccaacttggttggaaaaa
tttaccaattctgactacaagttacacaacaccatggccatgtttgtaggtttgacaacg
ctgatgctgagtgaaaacgaactggcaagattcaatacacatgtttacctgaagaaaata
tataactggtatatcgcatggcactctaatctatcttcagcatttccccaggacgatgaa
gtgaacagcttagcaaaaagggttctggacttattaaaagttgccacacaggaagatagc
atccaatttgaccaacaaaatggtattctctataaagagtgtagggaagctttacctgtt
tgggctttttacaaaaaaatcaagagctatattaaactgcaacgatccaatagcaaatca
aagcaaattgatcaattatttattacacacagaggactgaaagacagggaatggatgaag
tactctcttttagcacctagtaagtttgagggatctgtcggggaagttttgcccggcctt
cacgaaggattggctgatattgatagaaacgaggtcattcagtggttaaccattttgcta
agccaattcagcaacgttcgctatttacttcaataa

DBGET integrated database retrieval system