KEGG   Saccharomyces cerevisiae (budding yeast): YJR127CHelp
Entry
YJR127C           CDS       T00005                                 

Gene name
RSF2, ZMS1
Definition
(RefSeq) Rsf2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fungal_trans zf-C2H2 zf-H2C2_2 zf-C2H2_4 Carb_bind
Motif
Other DBs
NCBI-GeneID: 853592
NCBI-ProteinID: NP_012661
SGD: S000003888
UniProt: P46974
Position
X:complement(658917..663059)
Genome map
AA seq 1380 aa AA seqDB search
MEPFAFGRGAPALCILTAAARINLDNFVPCCWALFRLSFFFPLDPAYIRNENKETRTSWI
SIEFFFFVKHCLSQHTFFSKTLAPKRNFRAKKLKDIGDTRIDRADKDFLLVPEPSMFVNG
NQSNFAKPAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYL
CIFCGRCFARRDLVLRHQQKLHAALVGTGDPRRMTPAPNSTSSFASKRRHSVAADDPTDL
HIIKIAGNKETILPTPKNLAGKTSEELKEAVVALAKSNNVELPVSAPVMNDKREKTPPSK
AGSLGFREFKFSTKGVPVHSASSDAVIDRANTPSSMHKTKRHASFSASSAMTYMSSSNSP
HHSITNFELVEDAPHQVGFSTPQMTAKQLMESVSELDLPPLTLDEPPQAIKFNLNLFNND
PSGQQQQQQQQQQNSTSSTIVNSNNGSTVATPGVYLLSSGPSLTDLLTMNSAHAGAGGYM
SSHHSPFDLGCFSHDKPTVSEFNLPSSFPNTIPSNSTTASNSYSNLANQTYRQMSNEQPL
MSLSPKNPPTTVSDSSSTINFNPGTNNLLEPSMEPNDKDSNIDPAAIDDKWLSEFINNSD
PKSTFKINFNHFNDIGFIYSPPSSRSSIPNKSPPNHSATSLNHEKASLSPRLNLSLNGST
DLPSTPQNQLKEPSYSDPISHSSHKRRRDSVMMDYDLSNFFSSRQLDISKVLNGTEQNNS
HVNDDVLTLSFPGETDSNATQKQLPVLTPSDLLSPFSVPSVSQVLFTNELRSMMLADNNI
DSGAFPTTSQLNDYVTYYKEEFHPFFSFIHLPSIIPNMDSYPLLLSISMVGALYGFHSTH
AKVLANAASTQIRKSLKVSEKNPETTELWVIQTLVLLTFYCIFNKNTAVIKGMHGQLTTI
IRLLKASRLNLPLESLCQPPIESDHIMEYENSPHMFSKIREQYNAPNQMNKNYQYFVLAQ
SRIRTCHAVLLISNLFSSLVGADCCFHSVDLKCGVPCYKEELYQCRNSDEWSDLLCQYKI
TLDSKFSLIELSNGNEAYENCLRFLSTGDSFFYGNARVSLSTCLSLLISIHEKILIERNN
ARISNNNTNSNNIELDDIEWKMTSRQRIDTMLKYWENLYLKNGGILTPTENSMSTINANP
AMRLIIPVYLFAKMRRCLDLAHVIEKIWLKDWSNMNKALEEVCYDMGSLREATEYALNMV
DAWTSFFTYIKQGKRRIFNTPVFATTCMFTAVLVISEYMKCVEDWARGYNANNPNSALLD
FSDRVLWLKAERILRRLQMNLIPKECDVLKSYTDFLRWQDKDALDLSALNEEQAQRAMDP
NTDINETIQLIVAASLSSKCLYLGVQILGDAPIWPIILSFAHGLQSRAIYSVTKKRNTRI
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgttcgcatttggacgaggggcgcctgcattatgcatactaaccgcggccgct
cgaataaatctggacaattttgttccgtgttgctgggcacttttccgtctgtctttcttt
ttcccgcttgaccctgcatatattagaaacgaaaacaaagaaacaaggacttcttggatt
tccatagagttttttttcttcgttaaacattgcctctctcaacacacgtttttctcgaag
actcttgcaccaaaaagaaactttagggcgaagaagctaaaagacattggcgatactaga
atagatagggcagataaagattttttattagtgccggagccaagtatgtttgtgaacggt
aatcaatctaatttcgctaagcccgctggtcaaggtattctgcccattcctaaaaaatct
cgaattattaagactgataagccaagaccgttcttgtgtcccacatgcactaggggtttt
gtcaggcaggagcatttgaagagacatcagcattcgcatacccgtgagaaaccgtatctt
tgtatcttttgcggtaggtgttttgctcgtagagatttagtgctcaggcatcagcaaaaa
cttcatgctgctcttgtaggtacgggggatccacggcgaatgacgccagcaccaaattcg
acttcttcttttgcctccaagcggcgccattccgtggcggcggatgatccaaccgacctt
catatcattaaaatagccggaaataaagagactattctacccaccccgaagaaccttgct
ggtaagacatctgaagaattgaaagaggccgtggttgccttggccaaatcaaataatgta
gaacttcccgtctcggccccagtaatgaacgataagcgagagaaaactcctcctagtaag
gcaggctccctaggatttcgagagttcaagttcagcacgaaaggcgtgccagttcactct
gcatcaagcgatgctgttatcgacagggcgaacactccctcttccatgcataagacgaaa
agacatgcgtctttctctgcatccagtgcaatgacttacatgtctagtagcaatagcccc
caccattcaattaccaatttcgagctcgttgaagacgctccgcatcaagtcggcttttct
actccacaaatgaccgcgaagcagctcatggaaagcgtgtcagaattggatttacctccg
ttaaccctggacgaaccaccgcaagctatcaagtttaacttaaatctatttaacaatgac
ccctccggacagcaacaacaacaacaacaacaacagcaaaattccacctctagtaccata
gtgaacagcaacaatggaagtacagttgctacacctggagtgtatctcttaagtagcggt
ccatctttaaccgatcttttgacaatgaactctgcacatgcaggtgcgggaggatacatg
tctagccaccattcgccatttgatttgggctgcttcagtcatgataaaccgacagtttct
gaatttaaccttccgtcaagcttcccgaatactataccgtctaattctactacggcttct
aatagttacagtaatttggcaaatcaaacttataggcaaatgagcaatgagcagccgctt
atgtcactatctcctaaaaacccaccaacaactgtttcagattcctcttccacgatcaat
ttcaatccaggcacaaataatttactggaaccatcaatggagcccaatgataaggatagt
aatatcgatcctgctgccatagatgacaagtggttatcagagtttattaacaactctgat
ccaaaatctaccttcaagatcaacttcaatcatttcaatgacattgggtttatttattct
ccaccttcatcaaggtcatctataccaaacaagtcacctccaaaccattctgctacctca
ttaaatcatgaaaaagcttctttatcacctcgcttaaacttgagtttgaatggaagcaca
gatttaccaagtacaccacaaaaccaactaaaggagccttcctattctgaccctatttcc
catagttctcataagaggcgtcgtgatagcgtcatgatggactacgatctatccaatttt
ttcagctcaaggcaattggatatttccaaggtattaaacgggacagagcaaaataattct
catgtgaacgacgatgttctcactttgtctttccccggcgaaactgattctaatgcaaca
cagaaacagctgcctgttcttactccttcggatttgttatctccgttttctgtcccttca
gtatctcaagtgctttttaccaatgagctaaggagtatgatgctagccgacaataatatc
gattcaggagccttccccacaactagtcaattgaacgattatgtgacttactataaggaa
gaattccatccatttttttcatttattcatcttccttctatcatacctaatatggacagt
tatcccttgttattatctatctccatggtcggagcattgtatgggtttcattcgacgcat
gcaaaagtgttagctaatgcagctagcacccaaattaggaaaagcttgaaagttagtgag
aaaaacccggagacgacagagttatgggttatacagacattagtattgctaacgttctac
tgtattttcaataaaaatacagccgtgatcaaggggatgcatggtcagttgacgactatt
attcgtctcttgaaggcctctcgtttaaatttgcccctagagtccctatgccagccgcct
attgagagtgatcatattatggaatatgaaaacagtcctcatatgttttcaaaaataaga
gagcaatacaacgcgccgaatcaaatgaacaaaaactaccaatattttgtattggcgcag
tcacgtatcaggacttgccatgcggtattacttatatctaacttattttcttcactggta
ggtgctgattgctgttttcattcagtcgatttaaaatgtggtgttccatgctataaagaa
gaattatatcagtgccgaaattccgatgaatggtcggacctattatgtcaatacaaaata
acgttagattcgaaattttcgttgattgaattgtctaatggtaacgaggcatatgaaaat
tgtttgaggtttctttctacaggcgatagttttttttacggaaatgctagggtttcgtta
agtacatgtctatcattgttgatatctatccatgagaaaatacttattgaaagaaataac
gcaaggatcagtaataacaacaccaatagcaataacattgagttggacgatattgagtgg
aagatgacttccagacaacggatcgatacaatgttaaaatactgggaaaacctttatttg
aaaaatggtggcatcttgacacctaccgagaatagcatgtcaacaataaacgccaatcca
gcaatgaggttaataattccggtatatttgtttgccaaaatgagacggtgtttggacctg
gcacatgttattgagaaaatctggttgaaagattggtccaatatgaataaagctttggag
gaagtttgctatgacatgggttcattgagggaagctaccgagtatgcactgaatatggtg
gatgcgtggacttcattttttacgtacattaaacagggcaagcgcagaattttcaatact
cctgtatttgcgaccacatgtatgttcactgcagtattagtgatttcggaatacatgaaa
tgtgtagaggattgggcacgcgggtacaatgccaacaaccctaactcagcattattggat
ttttcggaccgtgtcttatggctaaaagcagaaaggattttgagaagattacaaatgaac
ttgataccgaaggagtgtgatgtgttgaaatcgtacactgatttcttaagatggcaggac
aaggatgccctagatttgtcagcactaaatgaagaacaagcacaaagggccatggacccg
aataccgatataaatgagacaattcaactaattgtagcggcaagtctatcctccaaatgt
ttatatttgggtgttcaaatattgggtgatgcgccaatttggcctataatattatcgttc
gctcatggtttgcaatcaagagctatctatagtgttacgaaaaaaagaaacactagaata
taa

DBGET integrated database retrieval system