KEGG   Saccharomyces cerevisiae (budding yeast): YJR145CHelp
Entry
YJR145C           CDS       T00005                                 

Gene name
RPS4A
Definition
(RefSeq) ribosomal 40S subunit protein S4A
  KO
K02987  small subunit ribosomal protein S4e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YJR145C (RPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YJR145C (RPS4A)
Ribosome [BR:sce03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    YJR145C (RPS4A)
  Archaea
    YJR145C (RPS4A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT S4 KOW Sipho_tail dCache_2
Motif
Other DBs
NCBI-GeneID: 853610
NCBI-ProteinID: NP_012679
SGD: S000003906
UniProt: P0CX35 P0CX36
Structure
PDB: 

Position
X:complement(join(702027..702798,703055..703068))
Genome map
AA seq 261 aa AA seqDB search
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggaccaaagaagcatctaaaaagattagcagctccacaccactggttattg
gacaagttgtccggttgttacgccccaagaccatctgctggtccacacaaattgcgtgaa
tccttgccattgattgtctttctaagaaacagattaaagtatgctttgaacggccgtgaa
gtcaaggctatcttgatgcaacgtcacgttaaagtggacggtaaggttagaaccgacact
acctacccagctggtttcatggatgtcatcactctagatgccaccaatgaaaacttcaga
ttggtctacgatgtcaagggtagattcgctgtccaccgtatcaccgatgaagaagcttct
tacaagttgggtaaggtcaagaaggttcaattaggtaagaagggtgttccatacgttgtt
acccacgatggtagaactatcagatacccagacccaaacatcaaggtcaatgacactgtt
aagatcgacttggcctctggtaagattactgatttcatcaagttcgatgccggtaagttg
gtttacgttactggtggtcgtaacttgggtcgtatcggtactatcgttcacaaggaaaga
cacgatggtggtttcgatttagttcacatcaaggactccttggacaacactttcgtcact
agattgaacaatgtcttcgtcatcggtgaacaaggtaagccttacatttctttgccaaag
ggtaagggtatcaagttgtctattgctgaagaacgtgacagaagaagagctcaacaaggt
ttataa

DBGET integrated database retrieval system