KEGG   Saccharomyces cerevisiae (budding yeast): YJR152W
Entry
YJR152W           CDS       T00005                                 

Gene name
DAL5, UREP1
Definition
(RefSeq) allantoate permease
  KO
K08192  MFS transporter, ACS family, allantoate permease
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YJR152W (DAL5)
Transporters [BR:sce02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    YJR152W (DAL5)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 853617
NCBI-ProteinID: NP_012686
SGD: S000003913
UniProt: P15365
Position
X:719666..721297
AA seq 543 aa
MSADASTNSNASLDEKNLNITSEAEIKNEDVTAEPVLSTVLSPNGKIVYISDKVDEAMKL
AEEAKEIEVTPEEDRKLRWKIDYCMFPLMCILYAVQFMDKISTSSAAVMGLRTDLKMHGD
QYSWVTSAFYFGYLFMNLGPVQFIFQRTSHMSKMLAVFIVIWGMLLALHAAPTVKYPSFI
VLRVLLGCAESVVTPCFTIITAQYWKTEEQFTRVSIWFGMNGLGSILINAIAYGVYIHQD
SYAIKGWRTLFVITGVITIFIGILIFLWIPDDPSKARFLSKREKLMVVQRIRSNQQGFGN
HEIKKYQIIEALKDVRTWLYFLFTVSSNIPNGGISSFMSILLNSDFGYSSKETLLMGLPT
GAVELVGCPLFGILAVYAANKKIPFWKYKLSWAIFAAVLALIASCMLGFATNSKKARLAG
AYLWYISPVSFICVLSNISANSSGYSKKWTVSSINLVAYAAANLAGPQTFIAKQAPKYHG
AKVAMVVCYAVMIVLLSILLIVNLRENKRRDKIAAERGFPEETENLEFSDLTDFENPNFR
YTL
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgtcagcggatgctagtacaaattcgaatgcttccctagacgaaaaaaatttaaacatc
acttcagaagctgaaatcaagaatgaagacgtaaccgcggagccagttctaagcacggta
ctatcacccaacggtaaaattgtctacatcagtgacaaggttgatgaggccatgaagttg
gctgaagaagccaaagaaatcgaagtgacaccagaagaagatagaaaacttcgttggaag
atcgactattgtatgtttcctttgatgtgtatattgtatgctgttcaatttatggacaag
atttccactagttcagcggcggtcatgggattaagaactgacttgaaaatgcatggtgac
cagtattcatgggttacttccgccttttatttcggctatctatttatgaacctaggcccg
gtacagttcattttccaaaggaccagtcacatgtcaaaaatgcttgcggtttttattgtc
atatggggaatgttattagctttacatgcagctccaacagttaagtatccttctttcatt
gttttgagagtacttttaggttgcgcagaaagtgttgtcacaccttgctttaccattatc
actgctcaatactggaagacagaggaacaattcacaagagtatcaatttggtttggtatg
aacggtcttggctccatcctgatcaacgcaattgcgtacggtgtttacattcaccaggat
tcttatgctattaaaggctggagaaccttatttgtcattactggtgtgataacaatcttc
attggtatcttgatattcctgtggatccctgacgatccatcaaaagcaaggtttttatct
aaaagagagaaattaatggttgtccaaagaattaggtctaaccaacaagggttcggtaat
cacgagatcaaaaaataccaaattatagaggcgttgaaggatgttaggacgtggttatat
ttcctctttactgtgagctctaatattcctaatggtggtatttcaagttttatgagtatt
ctattgaatagtgattttggatattcatcaaaggaaaccctattaatgggtttacctaca
ggtgctgttgaattggtaggttgtccactttttggtattctagcagtttatgcagccaat
aagaagataccattttggaaatataagttgagttgggctatttttgcagctgtcttagca
ttgattgctagctgcatgttagggtttgcaacaaactccaaaaaagcaagactggctggt
gcttacctgtggtacatctcgcccgtctcatttatttgcgtactttccaatatcagtgcg
aattcctcgggatatagtaaaaaatggactgtatcttcaataaacttagtagcatatgct
gcagctaacttggcaggaccacaaacctttattgctaagcaggctcctaaatatcatggc
gctaaggtcgctatggtcgtatgttatgctgttatgatcgtgcttctatctatactgctc
atcgtcaatttaagggaaaacaagagacgtgataagatagctgccgagagagggttccct
gaagaaacagagaatttagagttttctgatttgactgattttgaaaatccaaatttcaga
tacactttatga

DBGET integrated database retrieval system