KEGG   Saccharomyces cerevisiae (budding yeast): YKL032CHelp
Entry
YKL032C           CDS       T00005                                 

Gene name
IXR1, ORD1
Definition
(RefSeq) DNA-binding transcription repressor IXR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_box HMG_box_2 CHDNT SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 853836
NCBI-ProteinID: NP_012893
SGD: S000001515
UniProt: P33417
Position
XI:complement(380065..381858)
Genome map
AA seq 597 aa AA seqDB search
MNTGISPKQDDASNSNLLNIGQDHSLQYQGLEHNDSQYRDASHQTPHQYLNQFQAQPQQQ
QQQQQQQQQQQQQAPYQGHFQQSPQQQQQNVYYPLPPQSLTQPTSQSQQQQQQQQQQQYA
NSNSNSNNNVNVNALPQDFGYMQQTGSGQNYPTINQQQFSEFYNSFLSHLTQKQTNPSVT
GTGASSNNNSNNNNVSSGNNSTSSNPAQLAASQLNPATAAAAAANNAAGPASYLSQLPQV
QRYYPNNMNALSSLLDPSSAGNAAGNANTATHPGLLPPNLQPQLTHHQQQMQQQLQLQQQ
QQLQQQQQLQQQHQLQQQQQLQQQHHHLQQQQQQQQHPVVKKLSSTQSRIERRKQLKKQG
PKRPSSAYFLFSMSIRNELLQQFPEAKVPELSKLASARWKELTDDQKKPFYEEFRTNWEK
YRVVRDAYEKTLPPKRPSGPFIQFTQEIRPTVVKENPDKGLIEITKIIGERWRELDPAKK
AEYTETYKKRLKEWESCYPDENDPNGNPTGHSHKAMNMNLNMDTKIMENQDSIEHITANA
IDSVTGSNSNSTNPNTPVSPPISLQQQPLQQQQQQQQQQQHMLLADPTTNGSIIKNE
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccggtatctcgcccaaacaggacgacgcctctaactccaacttactcaacata
ggccaagaccattcgctgcagtatcagggtctcgaacacaacgactcccagtacagagat
gcttctcaccagacacctcaccaatacttgaaccagtttcaagcccagcctcaacaacaa
caacagcagcagcagcagcaacaacagcaacaacaacaagcgccttatcaaggtcacttc
cagcagtcgcctcaacaacaacagcaaaatgtttattatccactacctccacaatctttg
acgcaacctacttcgcagtcgcaacaacaacaacagcaacaacaacaacaacagtatgct
aattcgaactcaaattcaaacaacaatgttaatgttaacgcgctacctcaggatttcggt
tacatgcaacaaaccggatcgggccaaaactatccgacgatcaatcaacaacaattttcc
gagttttacaactcctttttaagtcatttaactcaaaaacagacaaacccttctgtcacg
ggtacaggcgcgtctagtaacaacaacagtaacaacaacaatgttagtagcggcaataac
agcactagcagtaatcctgcccagctggcagcctcccaattaaaccctgccacggctgct
gcggccgccgcaaacaatgctgctggcccggcttcgtacttgtctcagctcccacaggtg
cagagatactacccgaacaacatgaacgctctgtctagtcttttggacccttcctctgca
ggaaatgctgcaggaaatgccaacaccgctactcatcctggtttgttaccacccaatctg
caacctcaattgactcaccaccagcagcagatgcagcaacagctgcaattacaacaacaa
cagcagttgcagcaacagcagcagctacaacagcaacaccagttgcaacaacaacaacaa
cttcaacaacaacatcatcatctacaacagcaacagcagcaacaacagcatccagtggtg
aagaaattatcttccactcaaagcagaattgagagaagaaaacaactgaaaaagcaaggc
ccaaagagaccttcttccgcttatttcctgttttctatgtccataagaaatgagttgctt
caacaattccctgaagcaaaggtccccgaattgtctaaattggcttctgcaaggtggaaa
gagttaacggatgatcaaaaaaaaccattctacgaagaattcagaaccaactgggagaag
tacagagttgtgagagatgcttacgaaaagactttgcccccaaagagaccctctggtccc
tttattcagttcacccaggagattagacctaccgtcgtcaaggaaaatcctgataaaggt
ttaatcgaaattaccaagataatcggtgaaagatggcgcgagttagaccctgccaaaaag
gcggaatacactgaaacttacaagaaaagattaaaggaatgggaaagttgttatcccgac
gaaaatgatccaaacggtaacccaaccggtcactcacataaggccatgaacatgaatttg
aatatggacactaaaatcatggagaaccaagacagtatcgagcacataaccgcaaatgcc
atcgactcagttaccggaagcaacagtaacagtaccaacccaaatacgcccgtttctcct
ccgatttcattacagcagcagccgctccaacaacaacaacaacagcagcaacaacaacaa
cacatgttattggctgaccccactacaaatggttcgatcataaaaaatgaataa

DBGET integrated database retrieval system