KEGG   Saccharomyces cerevisiae (budding yeast): YKL033W-AHelp
Entry
YKL033W-A         CDS       T00005                                 

Definition
(RefSeq) putative hydrolase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YKL033W-A
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     YKL033W-A
Protein phosphatases and associated proteins [BR:sce01009]
 HAD phosphatases
  Other HAD phosphatases
   YKL033W-A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD
Motif
Other DBs
NCBI-GeneID: 853833
NCBI-ProteinID: NP_012891
SGD: S000007242
UniProt: Q86ZR7
Position
XI:374505..375215
Genome map
AA seq 236 aa AA seqDB search
MTHPVAVKACLFDMDGLLINTEDIYTETLNETLAEFGKGPLTWDVKIKLQGLPGPEAGKR
VIEHYKLPITLDEYDERNVALQSLKWGTCEFLPGALNLLKYLKLKNIPIALCTSSNKTKF
RGKTSHLEEGFDLFDTIVTGDDPRIAKGRGKPFPDIWQLGLKELNEKFHTDIKPDECIVF
EDGIPGVKSAKAFGAHVIWVPHPEAHAVLGDTEALLAGKGELLSSLEKLEMSKYGL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcctgtagcagtgaaggcatgtctatttgacatggatggtcttctcatcaac
acagaggatatttatactgaaactttaaatgaaactctcgcagaatttggtaagggacct
ttaacttgggatgtgaagattaaattgcaagggcttccgggaccggaagcaggaaaaagg
gtgatcgaacactacaaattaccaataactttagatgagtacgacgaaagaaatgttgca
ttgcaatctcttaaatggggtacttgcgaatttcttcccggtgcattgaatttgttgaaa
tacttaaagttaaagaacattcctattgcattatgtacgtcttcgaacaagactaaattt
cgcggcaaaacaagtcatttagaggaaggttttgatcttttcgataccattgtcactggt
gatgatccaagaattgcaaaaggtaggggtaagcctttcccggacatttggcagttgggt
ttaaaggaattgaatgagaagtttcataccgatattaagcccgatgagtgtatagtgttc
gaagatggtattccaggcgtaaaatcagccaaggcatttggtgcacacgttatttgggtc
ccccatccagaagcacatgctgttttgggggacacagaagctttgttagccggtaaaggt
gaactattgtcttctttggaaaaactggaaatgtccaaatatggactgtga

DBGET integrated database retrieval system