KEGG   Saccharomyces cerevisiae (budding yeast): YKL039WHelp
Entry
YKL039W           CDS       T00005                                 

Gene name
PTM1
Definition
(RefSeq) Ptm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lung_7-TM_R
Motif
Other DBs
NCBI-GeneID: 853827
NCBI-ProteinID: NP_012885
SGD: S000001522
UniProt: P32857
Position
XI:362622..364193
Genome map
AA seq 523 aa AA seqDB search
MRVYQFCRPFQLFTCFLCYLLVFVKANKEKISQKNYQVCAGMYSKEDWKGKIDPFISFNL
KKISGLSDESDPGLVVAIYDFQDFEHLGVQLPDEEMYYICDDYAIDIGICEEENRDEFIV
QDVVYDPYTSTNRSLANPIMTFSQNEVGLHDTRYPIKETGFYCVTAFRSSTSTKFNAVVN
FRNAYGQLAGTEINKLPLYGLLAVAYVVAMALYSFAFWKHKHELLPLQKYLLAFFVFLTA
ETIFVWAYYDLKNEKGDTAGIKVYMVFLSILTAGKVTFSFFLLLIIALGYGIVYPKLNKT
LMRRCQMYGALTYAICIGFLIQSYLTDMEAPSPLILITLIPMALALIIFYYMIIRSMTKT
VIYLKEQRQIVKLNMYKKLLYIIYASFLSVLAGSIVSSFIYVGMNTIDMIEKNWRSRFFV
TDFWPTLVYFIVFVTIAFLWRPTDTSYMLAASQQLPTDPENVADFDLGDLQSFDDQDDAS
IITGERGIDEDDLNLNFTDDEEGHDNVNNHSQGHGPVSPSPTK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagagtatatcagttttgccgacctttccaattattcacctgcttcttatgctacctt
ctagtgttcgtaaaagctaacaaggaaaagataagtcaaaagaattatcaagtatgcgca
ggtatgtattccaaagaagattggaagggcaaaatagacccgtttatatcattcaatctt
aaaaaaataagtggattgagtgatgagtctgatccaggcttagtcgttgcaatctatgat
ttccaagactttgagcacttaggtgtgcaattgccggatgaagaaatgtattatatttgt
gatgattatgcaattgatatcgggatttgtgaagaggagaatcgtgatgagtttattgtt
caagatgttgtatatgatccatatacttccacaaatagatctttggccaatccaatcatg
acgttttctcaaaatgaggtcggccttcatgatactagatacccaataaaagaaaccgga
ttttattgtgttactgcgttcagatcatcgacgtctaccaagttcaacgctgtggtgaat
ttcaggaatgcttatggtcagcttgcgggcaccgagatcaacaaattgccactatatggt
cttttggcggtcgcatacgttgtggcgatggcgttatattccttcgccttctggaagcac
aagcatgaattgttaccattacaaaagtatttgctggccttttttgtatttttaaccgca
gaaaccatatttgtatgggcttactatgatttgaaaaatgaaaaaggtgatactgcggga
ataaaagtttatatggtgttcttgtcgatattgacggctggtaaagttacattttcattt
ttcctattattgattatcgctttgggctacggtatcgtgtaccctaagttgaataaaacg
ttgatgaggcgttgccaaatgtatggtgcgttaacttatgcaatttgcattggatttttg
atccaaagttatttgaccgacatggaggcaccatctccactaatcttgatcaccttgatt
cctatggcgcttgcattaatcatattttactacatgattattagatccatgacaaaaaca
gttatctatttgaaagagcaaaggcagatcgtaaaattgaacatgtacaagaagctacta
tacatcatttatgcgtcctttttgagtgtactagctggtagtatagtttcgtcatttatt
tacgttggcatgaacactattgatatgattgagaagaactggaggtcaaggttcttcgtt
actgatttctggcctacgttagtgtatttcattgttttcgttaccatcgcgttcttatgg
agaccaacagatacttcatacatgctagccgcatcccaacaactacccacagacccagaa
aatgtcgcggactttgacttgggcgatttgcaatcgtttgacgatcaagatgacgcaagt
atcatcactggtgagcgtggcatagacgaggatgacctcaatttgaattttactgatgat
gaagaaggacacgataatgtaaataaccatagccaaggccacgggccagtgtctccctct
ccaacaaaataa

DBGET integrated database retrieval system