KEGG   Saccharomyces cerevisiae (budding yeast): YKL041WHelp
Entry
YKL041W           CDS       T00005                                 

Gene name
VPS24, DID3, VPL26
Definition
(RefSeq) ESCRT-III subunit protein VPS24
  KO
K12193  charged multivesicular body protein 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Module
sce_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YKL041W (VPS24)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKL041W (VPS24)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKL041W (VPS24)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    YKL041W (VPS24)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YKL041W (VPS24)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Snf7 PAS_7 Eno-Rase_FAD_bd EMP70 Peptidase_S46 MukF_C
Motif
Other DBs
NCBI-GeneID: 853825
NCBI-ProteinID: NP_012883
SGD: S000001524
UniProt: P36095
Position
XI:360143..360817
Genome map
AA seq 224 aa AA seqDB search
MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT
VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR
LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK
NVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggattatataaaaaaagccatatgggggccagaccctaaggagcaacagaggagaatc
agatcggtcctgaggaaaaatggtcgaaatatagagaaatcgttgcgggaactcacagtt
ttgcaaaataaaacccagcagcttatcaagaaatctgcaaagaagaacgatgttaggaca
gttcgactatatgcaaaagaactgtaccaaatcaataaacaatatgatagaatgtacact
tccagagcgcagttggattctgttcgaatgaagatagatgaagcaatcagaatgaacact
ttgtcaaatcaaatggctgacagtgcgggcttaatgagggaggtaaattcattggttaga
ctacctcaattgagaaatacgatgattgaattagaaaaggaacttatgaaatctgggatt
ataagtgaaatggtggatgataccatggagagtgttggggacgtaggggaagagatggac
gaagctgttgatgaagaagttaataagatagttgaacaatacacaaacgagaaattcaag
aatgttgaccaagtgccaaccgtagaattagcagccaatgaagaagagcaagaaattccg
gatgaaaaagttgatgaggaagcagataggatggtaaatgaaatgcgtgaaaggctgaga
gctttgcaaaactag

DBGET integrated database retrieval system