KEGG   Saccharomyces cerevisiae (budding yeast): YKL042WHelp
Entry
YKL042W           CDS       T00005                                 

Gene name
SPC42
Definition
(RefSeq) Spc42p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spc42p UPF0242 DUF4116 GAS WEMBL Pox_A_type_inc Fez1 TMF_DNA_bd
Motif
Other DBs
NCBI-GeneID: 853824
NCBI-ProteinID: NP_012882
SGD: S000001525
UniProt: P36094
Structure
PDB: 

Position
XI:358475..359566
Genome map
AA seq 363 aa AA seqDB search
MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE
FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISD
LEKKLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKHRAPDATGNPRTTNKVSNT
SDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSPLNTILPINNRLNFQEPKRYNPT
VKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQSMMDGDD
NIKLDNVSKHNHATHRHSSQSSRDYSPSSDACLECSNDLYEKNRVKPENNMSETFATPTP
NNR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatctcccactcctaagcgatattcatccaaatcttcaaggctttacgacgac
tactataacatcccgtatcaatattccaatccgactccaatgaatagagactataatgac
gtggggtcacgtatcaatgcagataaactggtaccagaggaatacaaacggaatacagaa
tttatcaacaaagctgtccaacaaaataaagaacttaacttcaaactgagagaaaagcag
aacgaaatattcgaactcaagaagattgcagaaactctgcgctcaaagctcgaaaaatat
gttgacattaccaaaaagcttgaagaccaaaacctcaacctacagataaaaataagcgac
ctagaaaagaaactttctgacgctaattctactttcaaagaaatgagattccccaaggtc
aaggaccccatggtagatgacgaccctgtctccgaaaattatgatcagataaatgtacca
aaacacagagcaccggatgctacaggtaatcctcgtacaactaacaaagtctccaatact
tcagaccaagatagcagactaaaagccattgaaagaaccctctcggtcctcacaaattat
gttatgaggtcagaagacggtaataacgacaggatgtcacccttaccttctcctttaaat
acgatattgccaataaataatcgtctgaattttcaagagccaaagagatataatccaacc
gttaaggtaaatccgtctgatgacgatatcatgatgtatgaaagtgcagagctgaagcgt
gtcgaagaagaaatagaggagctaaagagaaaaatacttgttaggaaaaaacatgactta
agaaaattgtctttaaataaccaactccaagagctgcaaagcatgatggacggtgatgac
aatataaaacttgacaatgtttcgaagcataatcatgctacgcatcgtcattcttcccaa
tccagtcgcgattactcaccctcttcggatgcttgcttggagtgttctaatgatttatac
gagaaaaatagagtcaagcctgaaaataatatgtcagaaacattcgcaactcccactccc
aataatcgatga

DBGET integrated database retrieval system