KEGG   Saccharomyces cerevisiae (budding yeast): YKL047WHelp
Entry
YKL047W           CDS       T00005                                 

Gene name
ANR2
Definition
(RefSeq) Anr2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2347 Avl9 DUF4484 SPA
Motif
Other DBs
NCBI-GeneID: 853819
NCBI-ProteinID: NP_012877
SGD: S000001530
UniProt: P36090
Position
XI:349463..351013
Genome map
AA seq 516 aa AA seqDB search
MNSGGEEPTIKPNVFNITQLLNSNGEKPGIACIFLSKFDMKKGNIIIWSKSINGAAIDLS
NIEFKSLPAGIHEQTDDVVNFVVPKELDVCQTAKTTTYDYGIAYFKQNSFDIIENDNRID
RSKVQMFSLGVIIDVQNASSDSKKHFYKEIYHAYAANRYSSYLESLLGQWIRQRDLDKFD
IFEKFFDENNQGHMAENSVEVFEHSPKERRHLVEYLPYWTRKLGPLIFPLWKASLLQSRI
LILVPQGESFELCNSLAYCVFLISMLPKNLIGNHVSDEYIKPIFTVSTSDIPFLESFKKG
NGYVATTSEEILLYKPEIYDIVVKLTSSSTIEESPEKEVEILTASGEQNKATPLDLEVYE
KLILGELQEDASTNATCRHHEVTEPISWLQFLIDGFFLLTTAGYLVAPYHLANNFKIPRH
VSGPEPNNSEIQIAENLVRYFHRRTSNLYNDLKDVIQKSENIDSEQPITIAASFLTKLNL
DCFSKQDHQFVKDIALKWFQRSIDISNLPECLGNLC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaattccggaggtgaagaaccaactataaagccaaatgtatttaatattactcaactt
ttaaactcaaatggtgaaaaaccgggaattgcttgcatcttcttaagtaaatttgacatg
aaaaagggaaatatcataatatggtctaaaagtattaatggtgcggcaattgacttaagc
aatattgaatttaaatcgttaccagccggtattcacgaacaaactgacgatgttgtcaat
tttgtagttcctaaagaattagatgtctgtcaaactgccaagacgacaacttatgattac
ggcatcgcctatttcaaacaaaattcgttcgatattattgagaatgacaatcgtattgat
aggagtaaagttcaaatgttttctcttggtgtaattatcgatgtccaaaatgcctcatca
gatagtaaaaagcacttttataaggaaatataccatgcgtatgctgccaacagatactca
agctatctagaaagtttactcggtcaatggataaggcagcgtgatcttgataagtttgat
atttttgaaaagttttttgacgagaataaccaagggcacatggctgaaaattcagtagaa
gtctttgaacattcacccaaagaaagacggcatttggttgaatatttgccatactggaca
aggaagttagggcctctcatatttccactttggaaagcaagtctccttcagtcaaggata
ttgatactagttcctcaaggagaatcgttcgaattgtgcaattctttggcctattgtgtc
ttcttaatatcaatgcttccaaaaaacttgataggaaaccatgtaagcgatgaatatatt
aagcctattttcacggtatcaacatcagatattccttttctagagtcgttcaaaaagggg
aacggttatgtggctacgaccagcgaggaaattttgttgtataagcctgaaatttacgac
atagtagtcaaacttacttcgagctcaactatagaagaatcaccagaaaaagaagtggaa
attcttaccgcatctggtgaacaaaacaaagcaactcctcttgacttagaggtgtatgaa
aaacttatactgggggagttacaagaggatgcctctacaaatgcgacatgtcgacatcat
gaggtgacagaacccatatcatggctacagtttttaattgatgggttttttcttttaact
actgcaggctatctggtagcgccatatcaccttgcaaataatttcaagattccgaggcac
gtttctggcccagaacccaacaattcagaaatacagatcgctgaaaatttagttcgctat
tttcaccgcagaacatcaaatctgtacaacgatctgaaggatgtcatacaaaaaagtgaa
aatattgattcagaacaaccgattactatcgcagcttcatttttaaccaagttaaatttg
gattgctttagcaaacaagatcatcaattcgtcaaggatatcgcccttaaatggttccaa
agaagcattgatattagcaacctaccagaatgtttgggaaatctctgttaa

DBGET integrated database retrieval system