KEGG   Saccharomyces cerevisiae (budding yeast): YKL048CHelp
Entry
YKL048C           CDS       T00005                                 

Gene name
ELM1, LDB9
Definition
(RefSeq) serine/threonine protein kinase ELM1
  KO
K16314  serine/threonine-protein kinase ELM1 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YKL048C (ELM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YKL048C (ELM1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YKL048C (ELM1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  Other
   YKL048C (ELM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-GeneID: 853818
NCBI-ProteinID: NP_012876
SGD: S000001531
UniProt: P32801
Position
XI:complement(347214..349136)
Genome map
AA seq 640 aa AA seqDB search
MSPRQLIPTLIPEWAPLSQQSCIREDELDSPPITPTSQTSSFGSSFSQQKPTYSTIIGEN
IHTILDEIRPYVKKITVSDQDKKTINQYTLGVSAGSGQFGYVRKAYSSTLGKVVAVKIIP
KKPWNAQQYSVNQVMRQIQLWKSKGKITTNMSGNEAMRLMNIEKCRWEIFAASRLRNNVH
IVRLIECLDSPFSESIWIVTNWCSLGELQWKRDDDEDILPQWKKIVISNCSVSTFAKKIL
EDMTKGLEYLHSQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDANFEDCF
QRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFFGENEF
ETYHKIIEVSLSSKINGNTLNDLVIKRLLEKDVTLRISIQDLVKVLSRDQPIDSRNHSQI
SSSSVNPVRNEGPVRRFFGRLLTKKGKKKTSGKGKDKVLVSATSKVTPSIHIDEEPDKEC
FSTTVLRSSPDSSDYCSSLGEEAIQVTDFLDTFCRSNESLPNLTVNNDKQNSDMKTDRSE
SSSHSSLKIPTPIKAMIRLKSSPKENGNRTHINCSQDKPSSPLMDRTVGKRTVNNSGARK
LAHSSNILNFKAYINSEDSDIRETVEDVKTYLNFADNGQI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctcgacagcttataccgacattaattccggaatgggcaccattatcccagcaa
tcgtgcataagagaggatgagttagatagtcccccgataacgcctacgagccagacatct
tcatttggttcttctttttctcaacagaaaccaacctatagtacaattataggagaaaat
atacacacgatcctggatgaaattcgaccatatgtgaaaaaaataactgttagtgaccaa
gataagaaaactataaaccaatatacgctaggagtctctgcaggaagtggacaatttggt
tatgtacgaaaagcgtacagttctactttaggcaaggttgttgctgtcaagattatacca
aaaaaaccttggaatgcccagcaatattcagtaaatcaagtaatgaggcaaatccagctt
tggaagagtaaaggaaaaataacgacaaatatgagtggtaatgaggctatgagacttatg
aatatcgaaaaatgtaggtgggaaatttttgcggcttcaagacttcgaaataatgttcat
attgtgcgactaatagaatgcttggactctcctttcagcgaatctatctggatagtcact
aattggtgcagccttggtgaactacagtggaaacgtgacgatgatgaagatattttaccg
caatggaaaaaaattgtgatttcaaattgtagtgtttctacatttgccaaaaaaatcctg
gaggatatgacaaaagggttggaatatttgcattctcagggttgtattcatcgtgatatc
aaaccgtccaatattttattggatgaagaagaaaaagtagcgaaactttctgattttgga
agttgtattttcactccccaatcattacctttcagcgatgctaattttgaagattgtttt
cagagggaattgaacaaaattgttggtactccggcatttattgcaccagagctatgtcat
ttgggcaattccaaaagagattttgtgacggatggctttaagttggatatttggtcattg
ggagtgacactatactgcttactgtacaacgagctgccatttttcggggaaaatgaattc
gaaacctaccacaaaatcatcgaagtatcattgagttccaaaataaatggtaatacttta
aacgatttagtcattaaaaggttattggagaaagacgttactttacgcataagtattcag
gatttagtaaaggttttgtcgcgtgaccagcccatagattctaggaatcacagtcaaatt
tcatcgtccagtgtgaaccccgtaagaaacgaaggtcctgtaagaagattttttggtagg
ctactgactaaaaaaggaaagaaaaagacctcaggaaaagggaaagacaaggtattggta
tctgcaactagtaaagtaacaccttcgatacatatcgacgaggaaccggataaagaatgt
ttttcgactacggtccttagatcttcgccagactcgagcgattattgttcatcgttaggg
gaggaagccattcaggttacggatttcttagatactttttgtaggtcaaatgaaagctta
cctaatttgactgtgaataatgataagcagaattcggacatgaaaactgacagaagcgag
tcatcctctcattcgtcattgaaaatcccaacacctatcaaagccatgataagactaaag
agttcccctaaagagaacgggaacagaacccatattaattgctcacaggacaaaccgagt
tccccactaatggataggactgttggaaagcgcacggttaacaattcaggggctagaaag
cttgctcattcaagtaatattctcaactttaaagcatacataaattcggaagatagtgac
attcgagaaacagtagaagatgtaaaaacgtatctgaactttgcagataatggtcaaata
tag

DBGET integrated database retrieval system