KEGG   Saccharomyces cerevisiae (budding yeast): YKL049CHelp
Entry
YKL049C           CDS       T00005                                 

Gene name
CSE4, CSL2
Definition
(RefSeq) centromeric DNA-binding histone H3-like protein CSE4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CENP-S CENP-T_C
Motif
Other DBs
NCBI-GeneID: 853817
NCBI-ProteinID: NP_012875
SGD: S000001532
UniProt: P36012
Structure
PDB: 

Position
XI:complement(346075..346764)
Genome map
AA seq 229 aa AA seqDB search
MSSKQQWVSSAIQSDSSGRSLSNVNRLAGDQQSINDRALSLLQRTRATKNLFPRREERRR
YESSKSDLDIETDYEDQAGNLEIETENEEEAEMETEVPAPVRTHSYALDRYVRQKRREKQ
RKQSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQS
MAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQFI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaaacaacaatgggttagttctgctattcaaagtgattcgagtggaagatca
ctcagtaacgtcaacaggcttgcaggagaccaacaatctattaacgatcgtgcgttatcg
ttattgcagagaacaagagcgacaaagaacctgtttccaagaagagaggaaagaagacgt
tatgaaagctcaaaaagtgacctagatatcgaaacagactacgaagaccaagcaggtaat
ctagaaatcgagacagaaaatgaagaagaagctgaaatggaaactgaagtacctgcacca
gtgcgaactcattcatatgccttagacagatatgttagacagaaaaggagggaaaaacaa
agaaagcagagcttaaagcgcgtcgaaaagaaatatactcctagtgaattagctctgtac
gaaattcgaaaataccaacgttccacggatttattaatctccaaaattccatttgcaagg
ctagtgaaagaagttacagacgagtttacaactaaagatcaggatttacgttggcagtca
atggcgattatggcgttacaggaagcaagcgaagcgtatctggtaggattattggaacat
acaaacctcttggcgctgcatgcaaaaagaattactataatgaagaaagacatgcaacta
gcaagaagaatcaggggacagtttatttag

DBGET integrated database retrieval system