KEGG   Saccharomyces cerevisiae (budding yeast): YKL052CHelp
Entry
YKL052C           CDS       T00005                                 

Gene name
ASK1
Definition
(RefSeq) Ask1p
  KO
K11566  DASH complex subunit ASK1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YKL052C (ASK1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    DASH complex
     YKL052C (ASK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DASH_Ask1 LINES_N FRG2
Motif
Other DBs
NCBI-GeneID: 853814
NCBI-ProteinID: NP_012872
SGD: S000001535
UniProt: P35734
Position
XI:complement(339668..340546)
Genome map
AA seq 292 aa AA seqDB search
MDSASKEETLEKLDQEITVNLQKIDSNLSFCFHKITQDIIPHVATYSEICERIMDSTEWL
GTMFQETGLVNLQANAAAPVGNAPVKSLVSNNVGIFPTSAEEASRQSQTDNGPNEADSAV
HVNRDVHSMFNNDSIDDFHTANITSTGQILKLPDSSDEDTGSEAVPSREQTDLTGEGHGG
ADDEQDESTIQRQSRKRKISLLLQQQYGSSSSMVPSPIVPNKMRKQLAHEEHINNDGDND
DENSNNIESSPLKQGHHHPKGQADDNNEGPDEEESTKEVPKPGTIIHFSTNR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggattctgcaagcaaagaggaaacattggaaaaacttgatcaagaaattacagtgaac
ctgcagaagatagactctaacttgagtttctgctttcataagatcacccaggacatcatc
ccacacgtggctacatattcagaaatatgtgagcggatcatggatagcaccgaatggctg
gggactatgtttcaagagactgggctggtgaatttgcaggcaaatgcagctgcaccagtg
ggaaacgctccagtcaaaagccttgtgagcaataatgttggtatatttcctacatccgct
gaagaggcgagtaggcagtcccagacagacaatgggcctaacgaggcagattcagctgta
catgtcaaccgggatgtccattctatgtttaataacgacagtatagatgatttccacaca
gcgaatataacatccacgggacagatattgaaacttccggactctagcgacgaagatact
ggttcagaggcggtgccttcaagggagcaaacagaccttacaggcgagggtcatggtgga
gctgatgatgagcaagatgaaagtacaatacagagacaaagccgcaaaagaaagatttcg
ctacttttgcagcagcagtacgggtctagttccagcatggtaccgtctccgattgtgccc
aataaaatgcggaagcaactggctcatgaagaacatattaataacgacggcgataacgac
gatgagaacagcaataatatagagagctcgcctctgaagcaggggcaccaccacccgaag
ggacaagcggatgataacaacgaagggcccgatgaagaagagagtacgaaagaagtacca
aagcctgggaccatcattcatttttctacgaatagatag

DBGET integrated database retrieval system