KEGG   Saccharomyces cerevisiae (budding yeast): YKL054CHelp
Entry
YKL054C           CDS       T00005                                 

Gene name
DEF1, VID31
Definition
(RefSeq) DNA damage-responsive RNA polymerase-degradation factor DEF1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CUE
Motif
Other DBs
NCBI-GeneID: 853811
NCBI-ProteinID: NP_012869
SGD: S000001537
UniProt: P35732
Position
XI:complement(336537..338753)
Genome map
AA seq 738 aa AA seqDB search
MSTQFRKSNHNSHSSKKLNPALKSKIDTLTELFPDWTSDDLIDIVQEYDDLETIIDKITS
GAVTRWDEVKKPAKKEKYEKKEQQHSYVPQQHLPNPEDDITYKSSNNSNSFTSTKHNSSN
NYTQARNKKKVQTPRAHTTGKHVNLDKGKHVPSKPVSNTTSWAAAVSVDTKHDVPQDSND
NNNEELEAQGQQAQEKNQEKEQEEQQQQEGHNNKEEHKQIEQPSLSSKKTTSRTSASQPK
KMSWAAIATPKPKAVKKTESPLENVAELKKEISDIKKDDQKSEASEEKVNEQETSAQEQE
EETAEPSEENEDRVPEVDGEEVQEEAEKKEQVKEEEQTAEELEQEQDNVAAPEEEVTVVE
EKVEISAVISEPPEDQANTVPQPQQQSQQPQQPQQPQQPQQPQQPQQQQQPQQPQQPQQQ
LQQQQQQQQQPVQAQAQAQEEQLSQNYYTQQQQQQYAQQQHQLQQQYLSQQQQYAQQQQQ
HPQPQSQQPQSQQSPQSQKQGNNVAAQQYYMYQNQFPGYSYPGMFDSQGYAYGQQYQQLA
QNNAQTSGNANQYNFQQGYGQAGANTAAANLTSAAAAAAASPATAHAQPQQQQPYGGSFM
PYYAHFYQQSFPYGQPQYGVAGQYPYQLPKNNYNYYQTQNGQEQQSPNQGVAQHSEDSQQ
KQSQQQQQQQPQGQPQPEVQMQNGQPVNPQQQMQFQQYYQFQQQQQQAAAAAAAAAQQGV
PYGYNGYDYNSKNSRGFY
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtctacacaatttaggaagtctaatcataatagtcatagtagtaaaaaactaaatcct
gcgctaaagtccaaaatagatacgcttacagaattgttccctgactggacgagtgatgat
ttaattgatatagttcaagaatatgatgatttggaaactataattgataaaattacttcc
ggcgcagtgacaagatgggatgaagtaaagaaacctgctaagaaggaaaaatatgaaaaa
aaggagcaacaacactcatatgtccctcaacaacatttgccaaatccagaagatgatatt
acatataagagttctaataatagcaattcttttacttctacaaagcataacagtagtaac
aattatactcaagccagaaataagaagaaggtacaaacaccacgagctcatacaaccggg
aaacatgttaatctcgacaaggggaagcacgtaccatccaagcctgtttcaaacactaca
tcgtgggcagcagctgtttctgtagatactaaacatgacgttcctcaagattcaaatgat
aacaataatgaagaattagaagcacaagggcaacaagcgcaggagaaaaatcaagaaaaa
gagcaagaagagcaacaacagcaggaagggcataataacaaagaagaacacaaacaaata
gagcaaccttctttatcttcaaagaaaacaacttctaggacatctgcttcacaaccaaag
aaaatgtcgtgggctgcaattgctacaccaaagccaaaggctgttaaaaagaccgagtct
cctcttgaaaacgttgctgaattgaagaaagaaataagcgatattaagaaggatgaccaa
aagtctgaagctagtgaagaaaaagttaatgaacaagaaacatctgcacaagaacaagag
gaggagactgctgaaccttctgaagaaaatgaagacagagtccctgaagtggacggagaa
gaagtccaagaagaagctgaaaaaaaggaacaagtaaaagaagaggaacagacagcggaa
gagctggaacaagaacaagataatgttgctgctccagaagaagaagttacagttgttgaa
gaaaaggttgaaattagtgctgttatttcagagcctccagaagatcaagctaatactgta
cctcaaccacaacaacaatcccaacaaccacagcaaccacagcaaccacagcaaccacag
caaccacagcaaccacagcaacaacaacaaccacagcaaccacaacaaccacaacaacaa
ctacaacagcaacagcaacagcaacaacaaccagtacaagctcaagctcaagcccaagaa
gaacaattatctcaaaactactatactcaacaacagcagcaacaatacgctcaacaacag
catcagttacagcaacagtatttgtcccaacaacaacaatatgctcagcaacagcaacag
catccacaacctcaatcacaacaacctcaatcacagcaaagtccacaaagtcaaaaacaa
gggaacaacgtggctgcccaacagtactacatgtatcaaaaccaatttcctggatattct
tatccaggtatgtttgattcacaaggatacgcttacggtcaacaatatcagcaacttgct
caaaacaacgctcaaactagtggtaatgctaaccaatataatttccaacaaggttatggt
caagcaggcgcgaacactgctgctgctaatttgactagtgctgccgctgctgctgccgct
tctccagctacagctcacgcccaacctcaacaacaacagccatacggtggctcattcatg
ccatactacgcccacttttaccaacagtcattcccatatggtcaacctcaatacggtgta
gctggtcaatatccataccagttaccaaagaacaattacaactattaccaaactcaaaac
ggtcaggaacagcaaagtccaaatcaaggtgttgcccagcattctgaagactctcaacag
aagcaatcacaacagcaacagcaacagcaacctcaaggtcaaccccaacctgaagttcaa
atgcaaaatggccaacctgttaacccacaacaacaaatgcagttccaacaatactatcaa
ttccaacaacaacagcaacaagctgctgccgctgccgctgctgctgcccaacaaggtgta
ccatatggctacaacggttatgattacaattctaaaaattcaagaggtttctactaa

DBGET integrated database retrieval system