KEGG   Saccharomyces cerevisiae (budding yeast): YKL055CHelp
Entry
YKL055C           CDS       T00005                                 

Gene name
OAR1
Definition
(RefSeq) 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH)
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce00780  Biotin metabolism
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
sce01212  Fatty acid metabolism
Module
sce_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YKL055C (OAR1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YKL055C (OAR1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YKL055C (OAR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YKL055C (OAR1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     YKL055C (OAR1)
Lipid biosynthesis proteins [BR:sce01004]
 Fatty acid synthase
  Component type
   YKL055C (OAR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase KR DUF1776 Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 853810
NCBI-ProteinID: NP_012868
SGD: S000001538
UniProt: P35731
Structure
PDB: 

Position
XI:complement(335321..336157)
Genome map
AA seq 278 aa AA seqDB search
MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQ
CAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINC
AGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVN
ISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNL
PVEAKEMLERTIGASGTSAPAEIAEEVWSLYSRTALET
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcattatttgcctgttgcgatagtaacaggtgccactaggggtataggcaaggcaata
tgtcaaaagttatttcaaaagggtttaagttgcattatacttgggtctactaaagaaagt
atagagcgcaccgcgatagatagaggccaattacaatcgggattatcatatcagcggcaa
tgtgctatagcaattgattttaagaaatggcctcactggcttgactatgagtcatatgac
ggtatcgaatatttcaaagatagaccgcccttgaaacagaaatattccacattgttcgac
ccatgtaacaaatggtcaaataatgaacgccgctactacgtaaacttattgattaactgc
gcaggcttgactcaagaatcattaagtgtaagaaccactgcatctcaaattcaggacata
atgaatgttaactttatgagccctgtgacgatgacaaacatctgtattaagtatatgatg
aagtcgcaaaggagatggccggaactcagtggtcaatctgctcgacccaccatcgtaaat
atttcctccattctacactccggaaaaatgaaggttccaggtacatctgtttactccgcc
tctaaagccgcactgtccagatttacagaagttttagctgcagaaatggaaccaagaaac
attaggtgttttacgatatctccaggtttagtcaaagggaccgatatgatccaaaatttg
ccagtggaggctaaagaaatgctggagagaaccattggggcaagcggtacaagcgcaccc
gctgaaatagcggaagaagtctggtctctatacagtagaactgctttggagacgtaa

DBGET integrated database retrieval system