KEGG   Saccharomyces cerevisiae (budding yeast): YKL056CHelp
Entry
YKL056C           CDS       T00005                                 

Gene name
TMA19, MMI1
Definition
(RefSeq) Tma19p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TCTP RcbX
Motif
Other DBs
NCBI-GeneID: 853809
NCBI-ProteinID: NP_012867
SGD: S000001539
UniProt: P35691
Position
XI:complement(334412..334915)
Genome map
AA seq 167 aa AA seqDB search
MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNVGGDNIDIGANPSAEGGDDDVEEG
AEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKV
IGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEKI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgattatttacaaggatatcttctctaacgacgaattgttgtctgatgcttacgacgct
aagttagttgatgacgttatctacgaagccgactgtgctatggtcaatgtcggaggtgac
aacatcgatatcggtgctaacccatctgctgaaggtggtgacgatgatgttgaagaaggt
gctgaaatggtcaacaacgttgtccactctttccgtctacaacaaaccgcttttgacaag
aagtccttcttgacctacattaagggttacatgaaggctgttaaagctaagttgcaagaa
actaacccagaagaagttcctaaattcgaaaagggtgctcaaacttacgtcaagaaggtt
attggttctttcaaggactgggagttcttcactggtgaatccatggacccagatgccatg
gttgtcatgttgaactaccgtgaagatggtaccactccatttgttgccatctggaagcac
ggtattgtggaagaaaagatctaa

DBGET integrated database retrieval system