KEGG   Saccharomyces cerevisiae (budding yeast): YKL067W
Entry
YKL067W           CDS       T00005                                 

Gene name
YNK1, NDK1
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce00240  Pyrimidine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01240  Biosynthesis of cofactors
Module
sce_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sce_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YKL067W (YNK1)
   00240 Pyrimidine metabolism
    YKL067W (YNK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKL067W (YNK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     YKL067W (YNK1)
Membrane trafficking [BR:sce04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    YKL067W (YNK1)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 853798
NCBI-ProteinID: NP_012856
SGD: S000001550
UniProt: P36010
Structure
PDB: 
3B54

Position
XI:314812..315273
AA seq 153 aa
MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKP
FFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHG
SDSVDSAEREINLWFKKEELVDWESNQAKWIYE
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtctagtcaaacagaaagaacttttattgcggtaaaaccagatggtgtccagaggggc
ttagtatctcaaattctatctcgttttgaaaaaaaaggttacaaactagttgctattaaa
ttagttaaagcggatgataaattactagagcaacattacgcagagcatgttggtaaacca
tttttcccaaagatggtatcctttatgaagtctggtcccattttggccacggtctgggag
ggaaaagatgtggttagacaaggaagaactattcttggtgctactaatcctttgggcagt
gcaccaggtaccattagaggtgatttcggtattgacctaggcagaaacgtctgtcacggc
agtgattctgttgatagcgctgaacgtgaaatcaatttgtggtttaagaaggaagagtta
gttgattgggaatctaatcaagctaagtggatttatgaatga

DBGET integrated database retrieval system