KEGG   Saccharomyces cerevisiae (budding yeast): YKL103CHelp
Entry
YKL103C           CDS       T00005                                 

Gene name
APE1, API, LAP4, YSC1
Definition
(RefSeq) metalloaminopeptidase APE1
  KO
K01268  aminopeptidase I [EC:3.4.11.22]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YKL103C (APE1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKL103C (APE1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.22  aminopeptidase I
     YKL103C (APE1)
Peptidases and inhibitors [BR:sce01002]
 Metallo peptidases
  Family M18
   YKL103C (APE1)
Membrane trafficking [BR:sce04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    YKL103C (APE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M18 DUF4942
Motif
Other DBs
NCBI-GeneID: 853758
NCBI-ProteinID: NP_012819
SGD: S000001586
UniProt: P14904
Structure
PDB: 

Position
XI:complement(246138..247682)
Genome map
AA seq 514 aa AA seqDB search
MEEQREILEQLKKTLQMLTVEPSKNNQIANEEKEKKENENSWCILEHNYEDIAQEFIDFI
YKNPTTYHVVSFFAELLDKHNFKYLSEKSNWQDSIGEDGGKFYTIRNGTNLSAFILGKNW
RAEKGVGVIGSHVDALTVKLKPVSFKDTAEGYGRIAVAPYGGTLNELWLDRDLGIGGRLL
YKKKGTNEIKSALVDSTPLPVCRIPSLAPHFGKPAEGPFDKEDQTIPVIGFPTPDEEGNE
PPTDDEKKSPLFGKHCIHLLRYVAKLAGVEVSELIQMDLDLFDVQKGTIGGIGKHFLFAP
RLDDRLCSFAAMIALICYAKDVNTEESDLFSTVTLYDNEEIGSLTRQGAKGGLLESVVER
SSSAFTKKPVDLHTVWANSIILSADVNHLYNPNFPEVYLKNHFPVPNVGITLSLDPNGHM
ATDVVGTALVEELARRNGDKVQYFQIKNNSRSGGTIGPSLASQTGARTIDLGIAQLSMHS
IRAATGSKDVGLGVKFFNGFFKHWRSVYDEFGEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaggaacaacgtgaaatactggaacaattgaagaaaactctgcagatgctaactgta
gagccatctaaaaataaccaaatcgccaacgaagaaaaggaaaagaaagaaaatgaaaat
tcgtggtgcatcctcgagcacaattatgaggatattgcacaggaattcattgatttcatt
tacaagaaccctaccacttaccatgtagtatcatttttcgcggagctgttagataagcat
aacttcaaatacttgagcgagaaatccaattggcaggactccattggcgaagatggtggg
aaattctacactataagaaatggaactaacctatctgcctttatcctgggcaaaaactgg
agagccgaaaagggtgtcggtgtcattggatctcatgtggacgctttgacggtcaaattg
aagcccgtctcctttaaagacacagcggaaggttacggaagaattgctgttgctccctat
ggaggtacactgaatgaattgtggctagacagagacctaggtattggtggtcgccttctt
tacaagaagaagggcactaacgaaattaaaagcgccttggttgattctacacccctacct
gtttgtcgaattccttccttggctccccatttcggtaaacctgctgaaggcccatttgat
aaagaggaccaaactatcccggtcatcggcttccccactccggatgaggaaggtaatgaa
cctcccacggatgatgaaaagaaatcgcccttatttggcaaacactgcatccacctgtta
aggtacgttgccaaattagccggtgtggaagtgtccgaattgattcaaatggatttagac
ttattcgatgtgcaaaagggtaccattggaggtattggtaaacacttcctttttgcacca
cgtctagatgacaggttgtgtagtttcgcagcaatgattgctttgatttgctacgctaag
gatgttaataccgaggaatcagatttattctctactgtcactttgtatgataatgaagaa
atcggatcgttgacaagacaaggcgcaaaaggtggcttgttggagtcagtggtggaacgc
agttcttctgcattcactaagaaaccggtcgatttgcatacggtttgggctaattccatc
atcttgtccgcagacgtcaaccacctctacaacccaaactttcctgaagtctatttgaag
aatcattttccagtgcctaatgtcggaatcactttatcactggatcctaacggtcatatg
gccacagatgtcgtaggaactgccctagtagaagaattagcacgccgcaatggagacaaa
gtgcaatatttccaaatcaaaaacaactcaagatcaggtggtactatcggcccatcattg
gcttctcaaacaggtgctcgtaccatagacctgggaattgcacagttgtccatgcacagc
atcagagctgctacagggtccaaggatgtcggattaggtgttaagttcttcaacggattt
ttcaagcactggagatcagtctacgatgaattcggcgagttgtga

DBGET integrated database retrieval system