KEGG   Saccharomyces cerevisiae (budding yeast): YKL120W
Entry
YKL120W           CDS       T00005                                 

Gene name
OAC1
Definition
(RefSeq) Oac1p
  KO
K15117  solute carrier family 25, member 34/35
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YKL120W (OAC1)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YKL120W (OAC1)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 853739
NCBI-ProteinID: NP_012802
SGD: S000001603
UniProt: P32332
Position
XI:217344..218318
AA seq 324 aa
MSSDNSKQDKQIEKTAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASA
AKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQ
EPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVT
IFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG
LGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTI
MCLTFMEQTMKLVYSIESRVLGHN
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtcatctgacaactctaaacaagataaacaaattgaaaaaacagccgcccagaagata
tcgaagtttggttcgtttgtggctggtgggctagcagcatgtatagctgttacagttact
aatccgatcgaattgattaaaatcagaatgcagcttcaaggtgaaatgtcagcatcagct
gcaaaagtttataaaaatccaatccaaggtatggcggtaattttcaaaaacgaaggtata
aaaggtctgcaaaaagggttaaatgctgcttatatctatcaaattgggctaaatggttcc
agattagggttttatgagccaatcagatcatcattaaatcagcttttcttcccagatcaa
gagccacataaggtacagagcgtcggagttaacgtcttttctggtgccgcatctggtata
attggtgcagtcattggctctccattattcttggtgaaaacaagacttcaatcatattcc
gagtttataaaaattggtgaacaaacgcactacaccggtgtttggaacgggttagtaacc
atttttaaaaccgaaggtgttaagggtctattcagaggtattgatgcggcaattttaagg
acaggtgctggttcctctgttcaactacctatctacaacacagcaaagaacattttggtc
aaaaatgatctgatgaaagatggcccagcattacatttaactgctagtactatctctggg
ttaggtgttgccgtcgttatgaacccatgggatgtcattttgacaagaatctataatcaa
aaaggtgacttgtacaagggacctatagattgtttggtcaaaactgttagaatcgaaggt
gtaaccgctttgtataagggttttgcagctcaagtgttcagaatcgcacctcatacaatc
atgtgtttgaccttcatggaacagacaatgaaactagtttattcgatagagtcgagagtt
ttaggccataattaa

DBGET integrated database retrieval system