KEGG   Saccharomyces cerevisiae (budding yeast): YKL126W
Entry
YKL126W           CDS       T00005                                 

Gene name
YPK1, SLI2
Definition
(RefSeq) serine/threonine protein kinase YPK1
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YKL126W (YPK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YKL126W (YPK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   YKL126W (YPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like FOXO_KIX_bdg Kdo
Other DBs
NCBI-GeneID: 853733
NCBI-ProteinID: NP_012796
SGD: S000001609
UniProt: P12688
Position
XI:205707..207749
AA seq 680 aa
MYSWKSKFKFGKSKEEKEAKHSGFFHSSKKEEQQNNQATAGEHDASITRSSLDRKGTINP
SNSSVVPVRVSYDASSSTSTVRDSNGGNSENTNSSQNLDETANIGSTGTPNDATSSSGMM
TIKVYNGDDFILPFPITSSEQILNKLLASGVPPPHKEISKEVDALIAQLSRVQIKNQGPA
DEDLISSESAAKFIPSTIMLPGSSTLNPLLYFTIEFDNTVATIEAEYGTIAKPGFNKIST
FDVTRKLPYLKIDVFARIPSILLPSKTWQQEMGLQDEKLQTIFDKINSNQDIHLDSFHLP
INLSFDSAASIRLYNHHWITLDNGLGKINISIDYKPSRNKPLSIDDFDLLKVIGKGSFGK
VMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKL
YFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDY
QGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLT
GLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGYNGADEIRNHP
FFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDEYLSESVQKQFGG
WTYVGNEQLGSSMVQGRSIR
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtattcttggaagtcaaagtttaagtttggaaaatctaaagaagaaaaagaagccaaa
catagtgggttttttcactcctctaaaaaggaagaacagcagaataatcaagcaactgcg
ggggaacatgatgcttcaattactcgttcatctttagacaggaagggcacgataaatcca
tcaaattcatcagtggtcccggttcgtgtttcatacgatgcatcctcatcgacctctact
gtacgagattcaaatggtggtaattcagaaaacacgaactcatctcaaaatttagatgaa
acagcaaatattggttctacagggacacccaatgatgccacctcaagttcaggaatgatg
actatcaaagtatataatggtgatgactttattttaccttttccgattacctcaagcgag
caaatattgaataaactattggcctcgggtgttccaccgccacataaggagattagtaaa
gaagtagatgctttaattgcacaactgtcccgtgttcaaataaagaaccaaggtccagct
gatgaagatttgatctctagcgagtcagcagcaaagttcatcccatctactatcatgtta
ccagggtcttcgaccttaaatcccttactatatttcaccattgaatttgataatacagtt
gcaactattgaagcagagtatggtacgatcgctaaacctggtttcaataagatatctacc
tttgatgtgacaaggaaattaccttatttaaagattgatgtatttgcaagaattccgtcc
attcttttgccctcgaagacatggcaacaggagatgggtttgcaagacgagaagctacag
accatttttgataaaataaattccaatcaagatatacatttagattctttccatttgccc
atcaacttaagttttgactctgcagctagtattagactatataatcaccactggatcaca
ttggataatggcttgggtaagatcaatattagtattgattataaaccttccagaaataaa
cctttgtccatcgatgatttcgatcttttgaaagttatcggtaagggttcgtttggtaaa
gtgatgcaagtcagaaagaaagatacacaaaaagtatacgctttgaaggcaatcagaaaa
tcatacattgtctctaaatccgaagtcacgcatactttggcagaaagaaccgttctagca
cgtgttgattgtccatttattgtacctttgaagttttctttccaatcaccggaaaaatta
tactttgttttagcgtttatcaatggtggtgagttgttttatcatctacaaaaggaagga
aggtttgatttatcacgtgccagattttataccgcagaattgttatgtgcgctagacaac
ttgcataaactagatgttgtctatcgtgatttgaaaccagagaatattttattggattat
caaggccacattgccctttgtgatttcgggctatgcaaattgaatatgaaggatgatgat
aagacagatactttttgtgggaccccagaatacttggcaccagaactattgctaggttta
ggctatacaaaggcagtagattggtggacattgggagtcttgttatacgagatgctcaca
ggtcttcctccttattatgatgaagatgttccaaaaatgtataagaagattctacaggag
ccactagttttcccagatggatttgatagagatgcaaaggatctattgattggattattg
agccgtgatccgacaagaagattgggctacaatggtgccgacgaaattcggaaccatcct
tttttcagccaattatcatggaagcgcctgttgatgaagggttatattccaccatataaa
ccagctgttagtaattccatggatactagtaatttcgatgaggaattcactagggagaag
ccaattgatagtgtggtagatgaatacttgagtgaaagtgttcaaaagcaatttggtggc
tggacatacgttggaaatgaacagctaggtagctcaatggtgcaaggtagaagcattaga
tag

DBGET integrated database retrieval system