KEGG   Saccharomyces cerevisiae (budding yeast): YKL135C
Entry
YKL135C           CDS       T00005                                 

Gene name
APL2
Definition
(RefSeq) Apl2p
  KO
K12392  AP-1 complex subunit beta-1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKL135C (APL2)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    YKL135C (APL2)
SSDB
Motif
Pfam: Adaptin_N Cnd1 HEAT_2 HEAT DUF5388 Arm
Other DBs
NCBI-GeneID: 853723
NCBI-ProteinID: NP_012787
SGD: S000001618
UniProt: P36000
Position
XI:complement(186460..188640)
AA seq 726 aa
MPPLDKRIKKFLKDSIRIAPKISGKGELSELRTGLVSQYPQTRKDAIKKTIQQMTLGKDV
SSLFPDVLKNIATIDVEQKKLVYLYVMNYAETHPELCILAVNTFITDAQDPNPLIRCMAI
RTMSMIRVDKILEYIETPLRRTLHDDNAYVRKTAVICVAKLFQLNKDLCVELGVVEDLVN
ALDDSNPLVIANATAALIEIHNMDMDAVDLSSLIQSHVSQFLLALNECTEWARIIILGTL
SEYSAKDSLEAQDIIDRVTAHLQHVNPAVVLATIKVIVRNLPQIEYSSNSLIMKRLSSAF
VSLMSTPPEMQYVALKNIRIILEKYPELLTKELRIFYVKFNDPLYVKLEKIDILVRLVDP
SNLKQCTLLLTELKEYAMEYEPEFVSRAIQALSQLGIKYAQESFVSKVLDILLELLERQD
TIKDDCCISLCDLLRHCPGNDKMAKQVCAVFNTWSNPEVLLQSDIAKCNYVWLLGQHPNN
FSDLESKINIFIENFVQEEALTQMSLLMTIVRLHATLTGSMLQSVLELATQQTHELDVRD
MAMMYWRCLSMPNNESLVNDLCQNKLPMISNTLEKFSPEVLEKLLMELGTISSIYFKPDS
NRRKGKKYVQNIVKGKHIEELESMAKNEISSKANDDVLLDFDERDDVTNTNAGMLNTLTT
LGDLDDLFDFGPSEDATQINTNDTKAVQGLKELKLGGDSNGISSGGKNNPDVSGGNIVSQ
DLLDLF
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgccaccattggataaaagaatcaagaagtttctaaaagactccattagaattgcgcca
aaaatatccggtaagggtgaactaagtgaattaagaactggattagtatctcaataccca
cagactcggaaagatgcaataaagaaaacgatccagcaaatgacgttgggaaaagatgtc
tcttcgctgttcccagacgtcttgaaaaacattgccacaattgacgttgaacaaaaaaaa
ctggtttatctttatgtgatgaattatgctgagacgcatcccgaattatgtattcttgcc
gttaacacattcattactgatgcacaagatccaaatcccttaattcgctgcatggcaatc
agaacgatgtcaatgataagagttgacaaaatcctggaatacattgaaacaccactccgc
cgtaccttgcatgatgataatgcatatgttagaaaaaccgcagtgatatgtgtcgcaaaa
cttttccaattaaacaaggatttatgcgttgagttgggtgtcgtcgaagatttggtcaat
gccctagatgactcaaatcctttagtcattgcaaacgcaacagcagcattaattgaaatt
cacaatatggatatggatgccgttgatctttcaagtttgatccagtcccacgtttcacaa
ttcttattagctttgaacgaatgtacggaatgggctagaattatcatactaggaactctt
tcggaatattcggcaaaagattctttagaggcacaagatatcattgatcgagtaactgcg
catttacaacacgttaatccagccgttgttttagctacaataaaggtaatcgtaaggaac
ttgcctcaaattgaatattcctcgaacagtctgataatgaaaagattatcatctgctttt
gtatcactgatgtctacgccgcctgaaatgcaatatgttgctttgaaaaatattaggatc
atattggagaaatatccagagctgttaaccaaagaattgagaatattttatgtcaagttc
aacgatcctctttacgtcaagttagagaagatcgatatccttgtaagactagtcgatcct
tccaacttgaaacaatgtactttgttgttgacagaattaaaggaatacgcaatggaatat
gaacctgagtttgtttcaagagctattcaagctttgtcccagttgggtattaaatatgca
caagaatcattcgtcagtaaagtcttggatattctcctagaattgttagaaagacaagac
acaataaaagacgactgctgtatatcattatgtgatttattaagacattgccccggaaac
gataagatggccaaacaagtttgtgcagtatttaatacttggtcaaatccagaggtgtta
ttacaatcagatattgcgaagtgcaactatgtctggttgctaggacagcatcccaacaat
ttctcagatttggagtcaaaaatcaatatttttatagagaactttgttcaagaggaagct
ttaacacagatgtctttactaatgacaatagtcagactacatgctactttaacgggtagt
atgctacaaagcgtcctagaattggccacacaacagacacatgaattagatgtgcgagat
atggctatgatgtattggagatgcctttcgatgccaaataatgaaagtttggttaatgat
ctatgtcaaaataaacttccaatgatctccaatacactggagaagttttcaccagaagtg
ctagagaaactattaatggaattgggtactataagttccatttatttcaagcccgactca
aataggagaaaaggcaaaaagtatgttcaaaatatagttaaaggaaaacatatagaggaa
ttagaaagcatggcaaaaaatgaaatttctagcaaggctaacgatgatgtgctattggat
tttgatgaaagagatgatgtaacaaatacaaatgcaggaatgctgaatactttaacaact
ttaggcgatttggatgatttatttgatttcggaccatctgaggatgccacacaaataaat
acaaatgataccaaggctgtacaagggttgaaggagctgaaactaggtggcgactcaaac
ggtatatcttctggtggtaaaaacaatcccgatgtttcgggcggcaatatagtgtcacag
gatctcctcgatttattctga

DBGET integrated database retrieval system