KEGG   Saccharomyces cerevisiae (budding yeast): YKL155C
Entry
YKL155C           CDS       T00005                                 

Gene name
RSM22
Definition
(RefSeq) mitochondrial 37S ribosomal protein RSM22
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Rsm22 Methyltransf_23 VWA_N
Other DBs
NCBI-GeneID: 853701
NCBI-ProteinID: NP_012767
SGD: S000001638
UniProt: P36056
Position
XI:complement(159456..161342)
AA seq 628 aa
MMKRCFSILPQNVRFSSKFTSLNLPKLDLADFIDSNKRGINVLPSYRDETASTTQATNSK
ELRLLSKTLQGQSYRDQLELNPDVSKAINNNIMAVHIPNNLRRVATNYYKEIQEPNSLHR
PCRTKMEVDAHIASIFLQNYGSIFQSLKELQKRVGPDNFKPQRILDVGYGPATGIVALND
ILGPNYRPDLKDAVILGNAEMQERAKIILSRQLNEVVDTVEENVSTEKEQETDRRNKNFQ
EDEHIGEVMTKKINIMTNLRSSIPASKEYDLIILTHQLLHDGNQFPIQVDENIEHYLNIL
APGGHIVIIERGNPMGFEIIARARQITLRPENFPDEFGKIPRPWSRGVTVRGKKDAELGN
ISSNYFLKVIAPCPHQRKCPLQVGNPNFYTHKEGKDLKFCNFQKSIKRPKFSIELKKGKL
LATSWDGSQGNASRLKGTGRRNGRDYEILNYSYLIFERSHKDENTLKEIKKLRNENVNGK
YDIGSLGDDTQNSWPRIINDPVKRKGHVMMDLCAPSGELEKWTVSRSFSKQIYHDARKSK
KGDLWASAAKTQIKGLGDLNVKKFHKLEKERIKQLKKEERQKARKAMESYNELEDSLQFD
DHQFSNFEVMKKLSTFHGNDFLQHVNRK
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgatgaaaagatgcttcagtatcctaccacaaaatgtccggttcagctcaaagttcaca
agtttaaacttaccaaagttagatttggcggattttatagactcaaataaaagaggaatc
aatgttcttccgtcgtacagagatgaaaccgctagcaccactcaagcaactaattctaaa
gagctcagattactttccaaaacacttcagggccagtcgtaccgggaccaattagagttg
aatcctgatgtaagcaaagcaatcaacaataatattatggctgtacatattcccaataat
cttagaagggttgctacaaattattacaaagagattcaggaaccaaattcattacatcgt
ccctgtagaaccaaaatggaagtggatgcacatatagcgtccatttttttacaaaattat
ggttctattttccaaagtctgaaagaattacaaaaaagggtaggtcctgataattttaaa
cctcaaagaatccttgatgttggatatggcccagcgactggtatagttgccttgaatgat
attttaggcccaaattatagacctgatctaaaagatgccgttattttagggaatgcggag
atgcaagaaagagccaaaatcattttgagcagacaacttaacgaggtggtcgatactgta
gaagaaaatgtgtctacagagaaagagcaggaaacagatagacggaacaaaaactttcaa
gaggatgaacatattggagaagtgatgacaaaaaagataaacattatgactaacttgcgg
tcttctattcccgcatctaaggaatatgacctcataatattaacgcatcaacttcttcat
gacgggaatcaatttccaattcaggtggatgaaaatattgagcactacttaaatattcta
gcgcctggaggccacattgttattattgaacgaggcaacccaatgggattcgagattata
gccagggcaaggcaaattacgcttagacctgaaaactttccagatgaattcggaaaaata
ccaagaccttggtctaggggagtaacagtcagaggcaaaaaagatgctgaattaggaaac
atttccagtaattattttctgaaggtgattgcaccttgtccacatcaaaggaaatgtccc
ttacaggttggaaatcctaacttttatactcataaagagggtaaagacttaaagttctgc
aattttcaaaaaagcatcaagcgtcccaaattcagtatagagttaaagaagggtaaactt
ctcgctacttcatgggatggttctcaaggaaatgcgtcgaggctaaaaggaacgggaaga
agaaatggtcgtgactatgaaattttaaactactcctatttaatattcgagagatcacat
aaggacgaaaatacgttgaaagaaattaagaaattacggaatgaaaatgtgaacggcaaa
tatgacattggatcactgggtgatgacacgcaaaattcctggcctagaattatcaatgat
cctgtcaaacgtaaaggtcatgttatgatggatttatgtgcgccatcaggagaacttgaa
aaatggacggtttcgcggtcgttttctaaacaaatataccacgatgccagaaagagtaag
aaaggtgatttatgggcctcagcggccaaaacacagattaaagggctgggagacttgaat
gttaagaagttccacaagctagaaaaggagagaatcaagcagttgaaaaaggaagaacgt
caaaaagctagaaaggctatggaatcttataatgaattggaggactctcttcaatttgat
gatcatcagttctcaaactttgaggtaatgaagaaattgtccacttttcacggcaacgat
tttttacaacatgtaaatagaaaatag

DBGET integrated database retrieval system