KEGG   Saccharomyces cerevisiae (budding yeast): YKL168CHelp
Entry
YKL168C           CDS       T00005                                 

Gene name
KKQ8
Definition
(RefSeq) putative serine/threonine protein kinase KKQ8
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YKL168C (KKQ8)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YKL168C (KKQ8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 853686
NCBI-ProteinID: NP_012753
SGD: S000001651
UniProt: P36004
Position
XI:complement(131288..133462)
Genome map
AA seq 724 aa AA seqDB search
MVMQEEKKRQQPVTRRVRSFSESFKNLFRPPRSRDSSPINVTRIPYRSSSTSPKRSSEPP
RRSTVSAQILDPKNSPIRQRSYTLKCCTPGLSHPFRQTGSGASNSPTRHRSISGEEQEIV
NSLPEYKRSASHTFHGIRRPRSRSSSVSSCDSSNGTTSSSDSQWAMDSLLDDSDNDLTPY
RGSNKDILKSKDRAPYNYIDDYNKKALRRATSYPNPLPSKQFYNERLYTRRSHPDEESLE
SLPRFAGADVQCIIEQNGFKVYEDGSHEHNIKLSGVIAKLEKGNSLPAHRQGSLSRPRLG
ITLSGLFKHHKNECDIENALSLLPNVEKSQTNHEKRTGQSPNDSNRSSPTQGREDYLKIV
NPDASLGSDELKLINSLSSRIHKSLQNYLQEKNLKPAECIGEQAPTFQDNYGHPVGLVGA
GAYGEVKLCARLRNEKDSPPFETYHDSKYIYYAVKELKPKPDSDLEKFCTKITSEFIIGH
SLSHYHKNGKKPAPNILNVFDILEDSSSFIEVMEFCPAGDLYGMLVGKSKLKGRLHPLEA
DCFMKQLLHGVKFMHDHGIAHCDLKPENILFYPHGLLKICDFGTSSVFQTAWERRVHAQK
GIIGSEPYVAPEEFVDGEYYDPRLIDCWSCGVVYITMILGHYLWKVASREKDMSYDEFYK
EMQRKNQFRVFEELKHVNSELATNRKIALYRIFQWEPRKRISVGKLLDMQWMKSTNCCLI
YDST
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgcaggaggagaagaagcggcaacaacctgtgacaagaagagtaaggtcattt
tctgagtcctttaaaaaccttttcaggccgcctcgttcaagagattcaagtcctattaat
gtcacccgaattccttatcgatcgtcttctacctcacccaagagaagctctgagccacca
agacgatcaaccgtatccgcacaaattttagatccaaaaaattctccaatacgccagcgt
agttatacattgaagtgttgcaccccgggcctgtcacatccatttagacagacaggaagt
ggtgctagtaatagtcctaccagacatcgctctatatctggggaagaacaggaaattgtt
aacagtttaccagaatacaaaagatctgcttctcatacttttcatggcatacggcgtcca
cgttcaagaagttcatctgtttcgtcatgtgacagttcaaatggaacgacaagttcatca
gacagtcaatgggctatggattctttactagatgattcagacaatgacctcacaccttat
cgtggctcgaacaaagatatactgaaaagtaaagaccgggcgccgtataattacatagat
gactacaataagaaggctttacgcagagcaacatcatatccaaatcctctcccctccaag
caattctataatgaaaggttatacaccaggaggtcacatccagatgaagaaagtttggag
agcttgcctcgatttgcaggagcagatgtgcaatgtataattgagcaaaatggcttcaaa
gtttacgaagacggaagtcatgaacataatataaagttatcaggggtaattgcgaaatta
gagaaaggtaactccttaccggcacatcgacagggatcattatctagaccaagattaggt
attactctttctggtctattcaaacatcataaaaatgaatgcgatattgaaaacgcttta
tctcttctgccaaacgtagaaaaatctcagacaaaccatgagaaaagaaccggtcaaagt
cctaacgatagcaaccgcagctcgcccacgcaaggaagggaagattatctaaaaatagtg
aatcccgacgcatcattgggcagtgatgagttgaagttgattaattcattatcaagcaga
attcataaaagtttacaaaattatttgcaagaaaaaaatctaaaaccggctgagtgtatc
ggcgagcaagcacctacttttcaagataattatggccatcctgttggtctcgttggcgct
ggagcttacggtgaagttaagctgtgtgccagactacggaatgaaaaggactccccccca
tttgaaacatatcatgatagcaaatacatatactatgctgtgaaagaattgaaacccaaa
ccagacagtgatttagagaagttctgtacaaagatcacctctgagtttattattgggcat
tccttgagccactaccacaaaaatggtaaaaaaccagcccccaatattctaaacgtattt
gatattctagaagacagttcttcgtttattgaagtaatggaattttgccctgctggtgac
ctttatggtatgctggtcggtaagtcgaaattaaagggccgattacatccgttagaagcc
gattgtttcatgaagcaactgcttcatggtgttaagttcatgcatgatcatggtatcgct
cattgtgatttaaaacctgaaaatattctcttttatccgcatggtctattgaaaatatgt
gacttcggtacaagttctgtatttcaaaccgcttgggaaaggagggttcatgctcaaaag
ggtataattggatcagagccttacgtagctccagaagagtttgttgatggggagtattac
gatccaagactgattgactgttggagttgtggcgttgtttatataacaatgatattgggg
cattatctttggaaagtagcttcgagagaaaaagatatgtcttatgatgaattttacaag
gaaatgcagcgtaaaaaccagtttagggtattcgaagaattaaagcacgtaaactcagag
ttggccacaaatagaaaaatcgcattatatcgcatctttcaatgggaaccaagaaaaagg
atttctgttggcaaacttttagatatgcagtggatgaaaagtacgaattgctgcctaata
tatgattccacataa

DBGET integrated database retrieval system