KEGG   Saccharomyces cerevisiae (budding yeast): YKL173WHelp
Entry
YKL173W           CDS       T00005                                 

Gene name
SNU114, GIN10
Definition
(RefSeq) U5 snRNP GTPase SNU114
  KO
K12853  114 kDa U5 small nuclear ribonucleoprotein component
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YKL173W (SNU114)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YKL173W (SNU114)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    YKL173W (SNU114)
 Complex C
   U5 SnRNP specific factors
    YKL173W (SNU114)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 EFG_C EFG_IV EFTUD2 MMR_HSR1 EFG_II
Motif
Other DBs
NCBI-GeneID: 853681
NCBI-ProteinID: NP_012748
SGD: S000001656
UniProt: P36048
Structure
PDB: 

Position
XI:122517..125543
Genome map
AA seq 1008 aa AA seqDB search
MEGDDLFDEFGNLIGVDPFDSDEEESVLDEQEQYQTNTFEGSGNNNEIESRQLTSLGSKK
ELGISLEHPYGKEVEVLMETKNTQSPQTPLVEPVTERTKLQEHTIFTQLKKNIPKTRYNR
DYMLSMANIPERIINVGVIGPLHSGKTSLMDLLVIDSHKRIPDMSKNVELGWKPLRYLDN
LKQEIDRGLSIKLNGSTLLCTDLESKSRMINFLDAPGHVNFMDETAVALAASDLVLIVID
VVEGVTFVVEQLIKQSIKNNVAMCFVINKLDRLILDLKLPPMDAYLKLNHIIANINSFTK
GNVFSPIDNNIIFASTKLGFTFTIKEFVSYYYAHSIPSSKIDDFTTRLWGSVYYHKGNFR
TKPFENVEKYPTFVEFILIPLYKIFSYALSMEKDKLKNLLRSNFRVNLSQEALQYDPQPF
LKHVLQLIFRQQTGLVDAITRCYQPFELFDNKTAHLSIPGKSTPEGTLWAHVLKTVDYGG
AEWSLVRIYSGLLKRGDTVRILDTSQSESRQKRQLHDISKTETSNEDEDEDDETPSCEVE
EIGLLGGRYVYPVHEAHKGQIVLIKGISSAYIKSATLYSVKSKEDMKQLKFFKPLDYITE
AVFKIVLQPLLPRELPKLLDALNKISKYYPGVIIKVEESGEHVILGNGELYMDCLLYDLR
ASYAKIEIKISDPLTVFSESCSNESFASIPVSNSISRLGEENLPGLSISVAAEPMDSKMI
QDLSRNTLGKGQNCLDIDGIMDNPRKLSKILRTEYGWDSLASRNVWSFYNGNVLINDTLP
DEISPELLSKYKEQIIQGFYWAVKEGPLAEEPIYGVQYKLLSISVPSDVNIDVMKSQIIP
LMKKACYVGLLTAIPILLEPIYEVDITVHAPLLPIVEELMKKRRGSRIYKTIKVAGTPLL
EVRGQVPVIESAGFETDLRLSTNGLGMCQLYFWHKIWRKVPGDVLDKDAFIPKLKPAPIN
SLSRDFVMKTRRRKGISTGGFMSNDGPTLEKYISAELYAQLRENGLVP
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgacgatttattcgatgagtttggaaatttgatcggagttgatccttttgac
tcggatgaagaagaaagtgtgctggatgagcaagaacaatatcaaaccaatacgtttgag
gggagcggcaacaacaatgagattgagagcagacaacttacctcgttaggaagtaaaaag
gaacttggaatttccttagagcacccttatggtaaggaagtggaagtattaatggaaact
aagaacacacagtcaccacagactccactggtagagccggttacagaacgaacaaagttg
caagagcatacaatttttacacaattaaaaaaaaacattccgaagactagatataatcga
gactatatgttatcaatggctaacattccggagaggataataaatgttggtgtcattgga
cctcttcactcaggtaagacctctttgatggatctcctagtaatcgactcacacaaacgc
ataccagatatgtctaagaatgtagaacttggatggaaaccgctaagatacctggataat
ttgaaacaagagattgaccggggtctttccattaaacttaatggttccactctactctgc
accgatttagaatccaagtctagaatgataaactttttggatgcaccagggcatgttaat
tttatggatgaaacggcagtcgcacttgcagcaagtgatttggttttaatcgtgatagat
gttgtagaaggtgttacatttgtggtagagcaattgataaaacaaagtattaaaaataat
gtagcaatgtgttttgttataaataaactcgacagattgattctagatttaaagttgcca
ccaatggacgcatacttgaagttaaatcatataattgcaaatatcaattcctttacgaag
ggaaacgtgttttcaccaatagacaataacataatatttgcgtctacaaagctgggcttc
acattcactatcaaggaatttgtttcttattattacgcccactccataccttcttctaag
atagacgactttaccacaaggctatggggtagcgtatattaccataaaggtaatttcagg
acaaaaccatttgaaaatgtagagaagtacccgactttcgttgaatttatcctcatcccg
ctttataaaatattttcctacgctttatctatggagaaagataaattaaagaatttgtta
aggtctaactttagagttaatttaagtcaagaggccctccagtacgatccgcaacctttt
ttaaaacacgttctacagttaatatttaggcaacaaaccggtcttgtagatgcgataacc
agatgttatcaaccatttgaattattcgacaataagacagctcatctttcaattccagga
aaatctacaccagaaggcactctttgggctcatgtactgaaaactgtggattacggtgga
gcagagtggtcccttgtacggatatactctggacttttgaagagaggggatacagtacgt
atacttgatacatcacaatctgaatctcgccaaaaaagacagttgcatgatatctcaaag
acggaaacctccaacgaagatgaagatgaagatgacgaaacgccttcatgtgaggtcgaa
gaaattggcttattaggtggcagatatgtctatccggttcatgaagcacacaaaggacag
atagtattaataaaaggtatttcaagtgcatatattaaatccgcgacgttgtactctgta
aagagtaaggaggacatgaaacagctaaaatttttcaaacctttagattatattaccgag
gcagttttcaaaattgttcttcaacctttactgccaagggaattacccaagttattggat
gccctgaacaaaatttcgaaatactacccaggcgttattattaaagttgaggaatctgga
gaacatgtaatactaggaaatggagagctgtatatggactgtttgttgtatgatctaaga
gcgagttatgcaaagatagaaattaaaatatctgatcctttaactgttttttctgaaagt
tgctcaaatgaatcgttcgcttcaatacctgtaagtaattcgatatctcgccttggtgag
gaaaatttaccaggtctgtcgattagtgtagccgctgaaccaatggactctaaaatgatt
caggatttgagcaggaacacattgggaaagggtcaaaactgcttggatattgacggaata
atggacaacccaaggaaactatccaaaatattgagaaccgagtatgggtgggattcgttg
gcatcaagaaacgtttggtctttttataatggcaacgtgttgattaatgacactttgcca
gatgaaatcagtcctgaattattatccaaatataaggaacaaataatacaaggattttac
tgggctgtaaaagaggggcctttggcagaagaaccaatttatggtgtacagtataaattg
ttatcgatctcagtaccttccgacgtaaacattgacgttatgaaaagtcaaattattccg
ctaatgaaaaaagcctgttacgttggcttactgacagcaatcccaattttattggaaccc
atctatgaagttgacatcacggtccacgcccccttgctgccaatagtagaggaacttatg
aagaagagacgtggaagcaggatatacaaaacaataaaagtggcagggacaccattgttg
gaggttcgtggacaagttccggttattgaatctgcaggattcgagacagatttgagatta
tctacgaatggtcttggtatgtgtcagctgtacttttggcacaagatatggaggaaggtt
cctggtgatgttttggataaagatgcgtttattccaaaattgaaacccgcacctatcaac
agtttaagtcgtgatttcgtgatgaaaacaagaaggcggaagggtatttctacaggtgga
tttatgtcaaatgatggtcctacgcttgaaaagtatataagcgctgaattatacgctcaa
ttaagagaaaatggcttagtaccgtga

DBGET integrated database retrieval system