KEGG   Saccharomyces cerevisiae (budding yeast): YKL174CHelp
Entry
YKL174C           CDS       T00005                                 

Gene name
TPO5
Definition
(RefSeq) Tpo5p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 PgaD
Motif
Other DBs
NCBI-GeneID: 853680
NCBI-ProteinID: NP_012747
SGD: S000001657
UniProt: P36029
Position
XI:complement(120380..122236)
Genome map
AA seq 618 aa AA seqDB search
MPEYTLLADNIRENIVHFDPNGLFDNLHTIVHEDDSQENEEAEHFNYDQVLDKSLLSRGS
IVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPMEL
HVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEAHL
IFYTVIVFYLVVTVVGLVNLKFARFIETINKVCVYWIIYAIIFIDILLLVFHKGKFRSLK
YALFHFDNNLSGYKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVL
LSAFSGVIFLIPIMLILPDNDLLFTNHKVLPIVNIFTKSTDSVVLSFFLVLLILGNLLFS
GIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGLLALIS
TAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIVWLLLS
MVSVCLPTQVPVTFKTMNYALMVYVFCILVITGLYFKWGKYNFRLPLADDIKAPIPSDAE
ETVFELEDSNVEHTLNSGTTVKESVENNSEEGFIKVHPKSSTENPFEENEENVITDYGDE
HHTAEQEFDLADDRRYDI
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgccagagtatacgctactggctgataatataagggagaatatcgttcatttcgatccg
aatggtttgtttgataacttgcacaccattgttcatgaagatgacagtcaagagaacgag
gaggccgagcatttcaattatgatcaggtgttggataaatcgttattgtcaagaggttct
attgtcggtctcggtttaggactaatgagtcccgttttaggaatgtgcactagtatggcc
attgggctaattaatggtggtccgttaactataatgctaggttttttaatcagtggagtg
tgtatatggttttcgtcgctttctcttggtgagattgtttcaaaatttccgatggaactg
catgttgggagtgccatgttggccccggagaaattgaaattagtatgttcgtggtacact
ggctggttaatgctcatagggaattggactatgagtaccagtattacttttgcaggcgct
caacttaccatttctttgattctgatgacgaactccaacctaatatccgaggcacacttg
attttttacacagtcattgtattttacttagttgtgactgttgtaggcctcgtgaatttg
aaatttgcaagatttattgaaacaataaacaaagtctgtgtttattggatcatatatgcc
attatatttattgatattcttctactagtattccacaaaggtaaatttcgatctttgaag
tacgcgctatttcactttgataataatctatcagggtataaaagcgcatttctttccttc
atcattggattccaacagtctaatttcacgttacaaggtttcagtatgttacctgcttta
gctgacgaagtcaaagttcctgagaaggatattccacgtggtatgtcgaatgcggtattg
ttatccgcgttctctggagtcatttttcttataccaataatgttaatcctgccagataat
gatttgctttttaccaatcataaggttctaccaatagtgaacatttttacaaaatcgact
gattcggtggtcttgtctttttttttagtgctcctaattttaggaaacttactgttttcc
ggaattggctcgattactacatcttctcgtgcggtatatagttttagtcgtgaccaggct
ataccatactacgataaatggacctacgtcgaaccggattctcagtcaaaagtccccaag
aattctgttgtattgagtatgataatatcatactttttaggtctgctagctttgatttca
acggccgcatttaatgcttttataggcgctgcagtgctctgtctttgttctgcgactttc
attccgttagtcttggtgctgtttacgagaagaagagctatccgaagcgcgccagtaaaa
atcaggtataagtttggttggttcatcaacattgtttctattgtgtggctcttgttatct
atggtttctgtttgcctaccaacgcaagtgcctgtaactttcaaaacaatgaattatgct
ttaatggtgtacgtattctgcattttagttatcactggtctttatttcaaatgggggaag
tataattttagattacccttggcagatgacatcaaggctccaattcccagtgatgcggaa
gaaactgtttttgaactagaggatagcaatgttgaacatactctaaactcgggaaccaca
gtgaaagagtctgtagaaaataattctgaagaaggtttcatcaaggtgcatcctaaaagt
agtacagaaaatccctttgaggaaaatgaggaaaacgtgataaccgattatggtgatgag
caccatacagcagaacaagaatttgatcttgccgatgatcgtagatatgatatatga

DBGET integrated database retrieval system