KEGG   Saccharomyces cerevisiae (budding yeast): YKL181W
Entry
YKL181W           CDS       T00005                                 

Gene name
PRS1, PRP1
Definition
(RefSeq) ribose phosphate diphosphokinase subunit PRS1
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00030  Pentose phosphate pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YKL181W (PRS1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YKL181W (PRS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     YKL181W (PRS1)
SSDB
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran
Other DBs
NCBI-GeneID: 853654
NCBI-ProteinID: NP_012740
SGD: S000001664
UniProt: P32895
Position
XI:107316..108599
AA seq 427 aa
MRKCKIFVGNSHPELGNMVCQRLGIEPAPCTLKKFANGETSVQIGVSVRDEDVYVIQSGS
PSINDDIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKRHRGAITARMLANLLVMAG
ADHVVSMDLHASQMQGFFTKPVDNLYGGPSLAKWIRENVEDYEDAVVVSKNPGGTKRVTA
LADSLKINFAMIHTDRRRSKDLYSQNKDLQQLKLRKQSMLRKNRPIIRQGDHPNEEENII
LSNGIQTARIRNGHVIGDDEADDDEDAILESDSELHSIDGLDSHGLGGTYDAVDSEDEEE
IPVLYREQLITLVGNVRGRSAIILDDMIDRPGSFISAAEHLVQNCGAKKVYVVATHGIFT
GDCLEELEKSDAIDTIVVTNTYPISGERIAGSKKLVTIDVSPIFAECIRRDHYGESISVL
FDSLAAL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgcgtaagtgtaaaatttttgttggtaactctcacccagagttgggtaatatggtttgc
caaagattaggtatcgaaccagctccatgtacattaaaaaaatttgcaaatggtgaaacg
tcagttcaaatcggtgtatctgttcgtgacgaagatgtgtatgtcattcaatctggttct
ccatccataaatgatgacattatggaactgttgattttagtttctgcctgtaggggcgga
tctgctaggaaaattacagcagtcattcctcaatttccttactctaaacaatgtaaaatg
aagagacacagaggcgctattactgcaaggatgttggccaatctgttggtcatggctggc
gctgatcatgttgtgtctatggaccttcatgcttctcaaatgcaggggtttttcaccaaa
ccagtcgataacctatacgggggccctagtttagcgaaatggattagagaaaatgttgaa
gactatgaagatgcagtagttgtctctaagaatccaggtggtactaaaagagttacagcc
ctggcggattctttgaagatcaactttgctatgatccatactgatcgtcgtcgttctaag
gatctgtattctcaaaacaaggatttgcaacaactaaagttgagaaagcaatcaatgttg
aggaaaaatagaccgatcatcagacaaggtgaccatccaaatgaggaggaaaacattatt
ttaagtaacggtattcaaactgctaggatccgtaacggccacgttatcggtgacgatgag
gcagacgatgatgaagacgctatcttagaatctgacagcgaattgcattctattgatggc
ttagactcgcatggcttgggcggtacatatgatgctgtcgactccgaagacgaagaggaa
atcccagttctctatagggaacaactgattacattggtcggaaacgtccgtggtcgctct
gccatcattctagatgatatgattgatagacctgggtcatttattagcgctgctgaacat
ttggtgcaaaattgtggtgccaaaaaggtttatgttgttgctactcacggtatattcact
ggagactgtttggaagaacttgaaaagtccgatgccattgacacaattgtggtcacaaat
acatatccgatttctggcgaacgcatagctgggtccaagaaattggttactatcgatgtt
tctccaattttcgcagaatgtatccgtcgtgatcattatggtgagagtatttccgtttta
tttgactctttggcagctctgtaa

DBGET integrated database retrieval system