KEGG   Saccharomyces cerevisiae (budding yeast): YKL182WHelp
Entry
YKL182W           CDS       T00005                                 

Gene name
FAS1
Definition
(RefSeq) tetrafunctional fatty acid synthase subunit FAS1
  KO
K00668  fatty acid synthase subunit beta, fungi type [EC:2.3.1.86]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00061  Fatty acid biosynthesis
sce01100  Metabolic pathways
sce01212  Fatty acid metabolism
Module
sce_M00082  Fatty acid biosynthesis, initiation
sce_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YKL182W (FAS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YKL182W (FAS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     YKL182W (FAS1)
Lipid biosynthesis proteins [BR:sce01004]
 Fatty acid synthase
  Yeast type
   YKL182W (FAS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 FAS_meander SAT MaoC_dehydratas FAS_N MaoC_dehydrat_N NMO
Motif
Other DBs
NCBI-GeneID: 853653
NCBI-ProteinID: NP_012739
SGD: S000001665
UniProt: P07149
Structure
PDB: 

Position
XI:100671..106826
Genome map
AA seq 2051 aa AA seqDB search
MDAYSTRPLTLSHGSLEHVLLVPTASFFIASQLQEQFNKILPEPTEGFAADDEPTTPAEL
VGKFLGYVSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALAAKLLQENDTTLVKTK
ELIKNYITARIMAKRPFDKKSNSALFRAVGEGNAQLVAIFGGQGNTDDYFEELRDLYQTY
HVLVGDLIKFSAETLSELIRTTLDAEKVFTQGLNILEWLENPSNTPDKDYLLSIPISCPL
IGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRKAI
TVLFFIGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQEQVQDYVNKTNSHL
PAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKAPSGLDQSRIPFSERKLKFSNRF
LPVASPFHSHLLVPASDLINKDLVKNNVSFNAKDIQIPVYDTFDGSDLRVLSGSISERIV
DCIIRLPVKWETTTQFKATHILDFGPGGASGLGVLTHRNKDGTGVRVIVAGTLDINPDDD
YGFKQEIFDVTSNGLKKNPNWLEEYHPKLIKNKSGKIFVETKFSKLIGRPPLLVPGMTPC
TVSPDFVAATTNAGYTIELAGGGYFSAAGMTAAIDSVVSQIEKGSTFGINLIYVNPFMLQ
WGIPLIKELRSKGYPIQFLTIGAGVPSLEVASEYIETLGLKYLGLKPGSIDAISQVINIA
KAHPNFPIALQWTGGRGGGHHSFEDAHTPMLQMYSKIRRHPNIMLIFGSGFGSADDTYPY
LTGEWSTKFDYPPMPFDGFLFGSRVMIAKEVKTSPDAKKCIAACTGVPDDKWEQTYKKPT
GGIVTVRSEMGEPIHKIATRGVMLWKEFDETIFNLPKNKLVPTLEAKRDYIISRLNADFQ
KPWFATVNGQARDLATMTYEEVAKRLVELMFIRSTNSWFDVTWRTFTGDFLRRVEERFTK
SKTLSLIQSYSLLDKPDEAIEKVFNAYPAAREQFLNAQDIDHFLSMCQNPMQKPVPFVPV
LDRRFEIFFKKDSLWQSEHLEAVVDQDVQRTCILHGPVAAQFTKVIDEPIKSIMDGIHDG
HIKKLLHQYYGDDESKIPAVEYFGGESPVDVQSQVDSSSVSEDSAVFKATSSTDEESWFK
ALAGSEINWRHASFLCSFITQDKMFVSNPIRKVFKPSQGMVVEISNGNTSSKTVVTLSEP
VQGELKPTVILKLLKENIIQMEMIENRTMDGKPVSLPLLYNFNPDNGFAPISEVMEDRNQ
RIKEMYWKLWIDEPFNLDFDPRDVIKGKDFEITAKEVYDFTHAVGNNCEDFVSRPDRTML
APMDFAIVVGWRAIIKAIFPNTVDGDLLKLVHLSNGYKMIPGAKPLQVGDVVSTTAVIES
VVNQPTGKIVDVVGTLSRNGKPVMEVTSSFFYRGNYTDFENTFQKTVEPVYQMHIKTSKD
IAVLRSKEWFQLDDEDFDLLNKTLTFETETEVTFKNANIFSSVKCFGPIKVELPTKETVE
IGIVDYEAGASHGNPVVDFLKRNGSTLEQKVNLENPIPIAVLDSYTPSTNEPYARVSGDL
NPIHVSRHFASYANLPGTITHGMFSSASVRALIENWAADSVSSRVRGYTCQFVDMVLPNT
ALKTSIQHVGMINGRKLIKFETRNEDDVVVLTGEAEIEQPVTTFVFTGQGSQEQGMGMDL
YKTSKAAQDVWNRADNHFKDTYGFSILDIVINNPVNLTIHFGGEKGKRIRENYSAMIFET
IVDGKLKTEKIFKEINEHSTSYTFRSEKGLLSATQFTQPALTLMEKAAFEDLKSKGLIPA
DATFAGHSLGEYAALASLADVMSIESLVEVVFYRGMTMQVAVPRDELGRSNYGMIAINPG
RVAASFSQEALQYVVERVGKRTGWLVEIVNYNVENQQYVAAGDLRALDTVTNVLNFIKLQ
KIDIIELQKSLSLEEVEGHLFEIIDEASKKSAVKPRPLKLERGFACIPLVGISVPFHSTY
LMNGVKPFKSFLKKNIIKENVKVARLAGKYIPNLTAKPFQVTKEYFQDVYDLTGSEPIKE
IIDNWEKYEQS
NT seq 6156 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttactccacaagaccattaaccctatctcacggttctttagagcacgtgctt
ctggtaccaaccgcttcatttttcattgcttcgcaattacaagaacaatttaataaaatt
ttgcccgaacccactgaagggtttgctgcagatgacgagcctaccacacctgctgaacta
gtggggaaattccttggctacgtatcttctctagtcgaaccttccaaggtcggtcaattc
gatcaggtcttgaacctttgcttaacagaatttgaaaactgttatttagaaggcaatgac
attcacgccttggctgctaaactattacaggaaaacgacacaactttagtgaagactaaa
gaactaattaaaaattatattaccgccagaataatggctaagagaccatttgacaaaaaa
tccaactctgctctttttagggccgtcggcgagggtaacgcacaattggtagccattttc
ggtggtcaaggtaacaccgacgactactttgaagaattgcgtgatctatatcaaacttat
catgtcttagtgggagatttaatcaagttctccgctgaaactttaagtgaactgattaga
actactttagatgctgaaaaagtctttactcaaggtttaaacatattggaatggttggag
aacccttcaaataccccagacaaggactatttactttccattccaatttcatgcccctta
attggtgtcattcaattggctcactacgtagttactgccaagcttttgggtttcactcca
ggtgagttaagatcttacttaaaaggtgctacaggtcactctcaaggtttggttactgct
gtcgccatagctgagacggattcctgggaatccttcttcgtctccgtaagaaaagcaatt
actgtattattcttcatcggtgttcgttgttacgaagcatacccaaacacttccctacca
ccatccatcttggaagattccttggaaaacaatgaaggtgttccatctccaatgttgtcc
atttccaatctaactcaagaacaagttcaagactatgtaaataagactaactctcatttg
ccagctggtaaacaagttgaaatttctctagtcaatggtgcgaagaatctagtcgtatcg
ggcccaccacaatcattatatggtttaaacttgactttaagaaaggccaaggccccatct
ggactggatcaatcaagaatcccattcagcgaaagaaaattgaagttctccaataggttc
ttacctgttgcatcaccattccattcccatctattggttccagcttcagatttgattaac
aaagacttagtcaaaaacaatgtcagctttaacgctaaagatattcaaatccccgtttac
gacacttttgatggttcagatctaagagtcctttcaggttccatttccgagagaatcgtc
gactgcatcattagattacctgtcaaatgggaaactactacacaattcaaagccacccac
atattagactttggtccaggtggagcttccggtttaggtgttttaacccatcgtaataaa
gatggtactggtgttcgtgttatcgttgccggtactctcgacattaacccagatgatgat
tacggattcaagcaagaaatctttgatgttactagtaatggtttgaagaaaaatccaaac
tggttggaagaataccatccaaaattaattaagaacaaatcaggcaaaatttttgtcgaa
acaaaattttctaaattaatcggtagaccacctttattggttcctggtatgacaccatgt
actgtttctccagatttcgtagctgctaccacaaatgctggttataccattgagttggcc
ggtggtggttacttttccgcagcaggtatgaccgccgctattgattctgtggtttctcag
atagaaaagggtagtaccttcggtatcaacttgatctacgtcaatccatttatgttacaa
tggggtattccattaatcaaggaactaagaagcaaaggttatccaattcaattcttgacc
attggtgctggtgtcccatcattggaagttgctagtgaatacatagagacattaggtttg
aagtacttgggtttgaaaccaggttccattgatgctatttcgcaagttataaacattgct
aaagcacatccaaacttcccaatagctttacaatggaccggtggtagaggtggtggtcat
cattctttcgaagatgcccacactccaatgttacaaatgtactccaagattagaagacat
ccaaacattatgttgatattcggttctggtttcggttctgctgatgacacttacccatac
ttaaccggtgaatggtccacaaaattcgattatccaccaatgccattcgatggtttccta
tttggttcgagggtcatgattgctaaggaagttaaaacttctcctgatgctaagaagtgt
attgctgcttgtactggtgttcctgatgataaatgggaacaaacctacaagaagccaact
ggtggtattgtcactgttcgctctgaaatgggtgaaccaattcacaaaattgccactcgt
ggtgttatgctatggaaggaattcgacgaaaccatcttcaacttaccaaagaataagttg
gtaccaactttggaagcaaagagagattacattatctcaagattgaacgccgatttccaa
aaaccatggtttgctaccgtcaacggtcaagcccgtgacctagccacaatgacatacgaa
gaagttgcaaagagattggtggaattaatgttcatcagatctaccaactcttggtttgat
gtcacatggagaacctttactggtgatttcctacgtcgtgtcgaagaacgtttcactaaa
agtaagacattgtctttaatccaatcctattctctactagacaagcctgatgaagctatt
gaaaaagtatttaatgcttatcctgccgctagggaacagttcttgaatgcgcaagatatt
gatcactttttgagcatgtgtcaaaatccaatgcaaaaaccagtgccttttgttccagtt
ttggatcgtagattcgagatttttttcaaaaaagattcgttatggcaatctgagcacttg
gaagccgtcgtcgaccaagacgttcaaagaacatgtatcctacatggacctgttgcagca
caattcactaaagtcatcgatgaaccaattaagagcattatggatggtattcacgatggt
cacatcaaaaagttactacatcaatattacggtgacgatgagtcaaagattccagcagtt
gagtactttggtggtgaaagccctgtagacgtacaaagtcaagttgattcttcctctgta
tctgaagactcagctgtttttaaggcaacatcctctactgatgaagaaagctggtttaag
gctttggcgggatccgaaattaactggagacatgcaagtttcttatgttcctttatcact
caagataaaatgtttgtttctaacccaattagaaaagttttcaagccaagccaaggaatg
gttgttgagatttccaacggcaatacttcttcaaagactgttgtcactctttcagaacct
gttcaaggtgaattgaaaccaactgttattttgaagttgttgaaggagaacataatccaa
atggaaatgattgagaacagaactatggatggtaagcccgtcagcttgccattgttgtac
aacttcaacccagataatggttttgctccaatctctgaagttatggaggacagaaaccaa
agaattaaggaaatgtactggaaattatggattgatgagcctttcaatttggactttgac
ccaagagatgtcattaagggcaaagatttcgagatcaccgctaaagaagtttatgacttt
acacacgctgttggaaacaattgtgaagacttcgtttctagacctgatagaacgatgttg
gccccaatggactttgctattgttgtcggatggagagccatcatcaaggccattttccct
aatacggtcgatggtgacttattgaagttggttcatttgtctaacggctacaagatgatt
cctggcgctaagccactgcaagttggtgatgttgtttcaactactgctgttattgaatct
gtcgtcaaccaacctacaggaaagattgtcgatgtggtaggtacattatcgagaaatggc
aagcctgtcatggaagtcacctcctcattcttctacagaggcaactatactgactttgaa
aacactttccaaaagactgttgaacctgtttatcaaatgcacatcaaaacttctaaagat
atagctgtcttgcgctctaaggagtggttccaattggacgatgaagacttcgatctgtta
aacaaaactttgactttcgaaactgaaactgaagttactttcaagaatgctaacatcttc
tcttcagtgaaatgttttggcccaattaaagttgaattgccaaccaaagaaaccgtggag
atcggtattgtcgattacgaagccggtgcctctcacggtaaccctgttgttgatttcttg
aagagaaacggttccacattggaacaaaaggtcaatctagaaaatcctattccaattgca
gtacttgattcgtacactccaagtaccaacgaaccatacgctagagtttctggtgatttg
aatccaattcacgtttcacgtcattttgcctcttacgcaaacttgccaggtactatcacg
cacggtatgttttcttctgcttccgtccgtgctttgattgaaaactgggctgctgacagt
gtttcatccagggtacgtggctacacttgtcaatttgttgacatggttttgcctaacact
gctttgaaaacatcgattcaacatgttggtatgatcaatggtagaaaattgataaagttt
gaaactagaaatgaagatgacgttgtagttttgactggtgaagccgaaattgaacaacct
gttactaccttcgttttcactggtcaaggttcacaagaacaaggtatgggtatggactta
tacaaaacttctaaagctgctcaagatgtttggaatagagctgacaaccatttcaaggac
acttatggtttctctatcttagacattgtcattaacaacccagttaacttaacaattcac
ttcggtggtgaaaagggtaagaggatcagagaaaactattctgctatgatctttgagact
atcgtggatggaaaattgaagactgaaaaaattttcaaggaaattaatgagcacagtact
tcttacacatttagatctgaaaaaggtttattgtctgctactcaatttacacaaccagct
ttaactttgatggaaaaagctgctttcgaagacttgaaatctaaaggtttgatcccagcc
gatgctacttttgctggtcactctttaggtgagtatgctgctttggcctctttggctgat
gttatgtctatcgaatctttagttgaagttgtgttctacagaggtatgactatgcaagtt
gctgttccaagagatgagttgggcagatccaactatggtatgattgccattaacccaggt
agagtcgctgcatcattctctcaagaagctttgcaatatgttgttgagagagttggtaag
agaaccggctggttggttgaaatcgtcaactacaacgttgaaaaccaacaatatgttgca
gctggtgatctaagagctttagacaccgttaccaatgttctaaacttcatcaaattacaa
aaaattgatattattgaactacaaaagtccttatctttggaagaagttgaaggtcatttg
tttgagatcattgacgaagcttccaagaaatctgctgtcaagcctcgcccacttaaattg
gagagaggttttgcttgtatcccattagttggtatttctgttcctttccattccacctac
ttgatgaatggtgttaaaccattcaagagtttcttgaagaagaatatcataaaagaaaat
gtgaaggttgctagattggccggaaagtacattccaaacttgactgcaaaaccattccag
gttactaaggaatatttccaggacgtttatgatttgactggctccgaacctatcaaggaa
atcatcgacaactgggaaaagtatgaacaatcctaa

DBGET integrated database retrieval system