KEGG   Saccharomyces cerevisiae (budding yeast): YKL184WHelp
Entry
YKL184W           CDS       T00005                                 

Gene name
SPE1, ORD1, SPE10
Definition
(RefSeq) ornithine decarboxylase SPE1
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00330  Arginine and proline metabolism
sce00480  Glutathione metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
Module
sce_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    YKL184W (SPE1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YKL184W (SPE1)
Enzymes [BR:sce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     YKL184W (SPE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC
Motif
Other DBs
NCBI-GeneID: 853651
NCBI-ProteinID: NP_012737
SGD: S000001667
UniProt: P08432
Position
XI:96757..98157
Genome map
AA seq 466 aa AA seqDB search
MSSTQVGNALSSSTTTLVDLSNSTVTQKKQYYKDGETLHNLLLELKNNQDLELLPHEQAH
PKIFQALKARIGRINNETCDPGEENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPD
TKVLSLLAELGVNFDCASKVEIDRVLSMNISPDRIVYANPCKVASFIRYAASKNVMKSTF
DNVEELHKIKKFHPESQLLLRIATDDSTAQCRLSTKYGCEMENVDVLLKAIKELGLNLAG
VSFHVGSGASDFTSLYKAVRDARTVFDKAANEYGLPPLKILDVGGGFQFESFKESTAVLR
LALEEFFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKLSENEAMIYTNDGVYGNMNCI
LFDHQEPHPRTLYHNLEFHYDDFESTTAVLDSINKTRSEYPYKVSIWGPTCDGLDCIAKE
YYMKHDVIVGDWFYFPALGAYTSSAATQFNGFEQTADIVYIDSELD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtactcaagtaggaaatgctctatctagttccactactactttagtggacttg
tctaattctacggttacccaaaagaagcaatattataaagatggcgagacgctgcacaat
cttttgcttgaactaaagaataaccaagatttggaacttttaccgcatgaacaagcgcat
cctaaaatatttcaagcgctcaaggctcgtattggtagaattaataatgaaacgtgcgac
cccggtgaggagaactcgtttttcatatgcgatttgggagaagtcaagagattattcaac
aactgggtgaaggagcttcctagaattaagccattttatgccgtcaaatgtaatcctgat
accaaggttttgtcattattagcagagttgggcgttaatttcgattgcgcttccaaagtg
gaaattgacagagtattatcgatgaacatctcgccggatagaattgtttacgctaatcct
tgtaaagtagcatctttcattagatatgcagcttcaaaaaatgtaatgaagtctactttt
gacaatgtagaagaattgcataaaatcaaaaagtttcatcctgagtctcagttgttatta
agaatcgctaccgatgactctaccgctcaatgtcgactttccaccaaatatggctgtgaa
atggaaaacgtagacgttttattaaaggctataaaggaactaggtttaaacctggctggt
gtttctttccacgtcggttcaggcgcttctgattttacaagcttatacaaagccgttaga
gatgcaagaacggtatttgacaaagctgctaacgaatacgggttgccccctttgaagatt
ttggatgtaggtggtggatttcaatttgaatccttcaaagaatcaactgctgttttgcgt
ctagcgctagaggaatttttccctgtaggttgtggtgttgatataattgcagagcctggc
agatactttgtagctacagcgttcactttggcatctcatgtgattgcgaagagaaaactg
tctgagaatgaagcaatgatttacactaacgatggtgtatacgggaacatgaattgtatt
ttattcgatcatcaagagccccatccaagaaccctttatcataatttggaatttcattac
gacgattttgaatccactactgcggtcctcgactctatcaacaaaacaagatctgagtat
ccatataaagtttccatctggggacccacatgtgatggtttggattgtattgccaaagag
tattacatgaagcatgatgttatagtcggtgattggttttattttcctgccctgggtgcc
tacacatcatcggcggctactcaattcaacggctttgagcagactgcggatatagtatac
atagactctgaactcgattga

DBGET integrated database retrieval system