KEGG   Saccharomyces cerevisiae (budding yeast): YKL186CHelp
Entry
YKL186C           CDS       T00005                                 

Gene name
MTR2
Definition
(RefSeq) Mtr2p
  KO
K14543  mRNA transport regulator MTR2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKL186C (MTR2)
   03015 mRNA surveillance pathway
    YKL186C (MTR2)
   03008 Ribosome biogenesis in eukaryotes
    YKL186C (MTR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKL186C (MTR2)
   03009 Ribosome biogenesis [BR:sce03009]
    YKL186C (MTR2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YKL186C (MTR2)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YKL186C (MTR2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mtr2 Glyoxal_oxid_N
Motif
Other DBs
NCBI-GeneID: 853649
NCBI-ProteinID: NP_012735
SGD: S000001669
UniProt: P34232
Structure
PDB: 

Position
XI:complement(92744..93298)
Genome map
AA seq 184 aa AA seqDB search
MNTNSNTMVMNDANQAQITATFTKKILAHLDDPDSNKLAQFVQLFNPNNCRIIFNATPFA
QATVFLQMWQNQVVQTQHALTGVDYHAIPGSGTLICNVNCKVRFDESGRDKMGQDATVPI
QPNNTGNRNRPNDMNKPRPLWGPYFGISLQLIIDDRIFRNDFNGVISGFNYNMVYKPEDS
LLKI
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaatagtaatactatggtaatgaatgacgcaaatcaagcacaaataacggcc
acatttacgaagaagatattagcgcatttggatgatccggactccaacaaattggcccaa
ttcgtacagctttttaatccaaacaactgcagaataatatttaatgctacccccttcgcg
caagcaacagtttttctgcaaatgtggcaaaaccaggtcgtacaaacacaacatgcccta
acaggagtagactatcacgctattccgggatccggcacgttgatatgcaacgtcaattgc
aaagtcagattcgacgaaagcggcagagacaagatggggcaagacgcgactgttcccatt
caaccaaataacactgggaacagaaatcgacccaacgatatgaacaagccaagacctcta
tggggtccatattttggcatttccctgcagctgatcatcgacgaccgcatatttagaaat
gattttaatggtgtaatatcggggtttaactataacatggtttacaaacccgaggattct
ctgctaaaaatttag

DBGET integrated database retrieval system