KEGG   Saccharomyces cerevisiae (budding yeast): YKL210WHelp
Entry
YKL210W           CDS       T00005                                 

Gene name
UBA1
Definition
(RefSeq) E1 ubiquitin-activating protein UBA1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YKL210W (UBA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YKL210W (UBA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKL210W (UBA1)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     YKL210W (UBA1)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   YKL210W (UBA1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKL210W (UBA1)
  Exosomal proteins of other body fluids (saliva and urine)
   YKL210W (UBA1)
  Exosomal proteins of colorectal cancer cells
   YKL210W (UBA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF UBA_e1_thiolCys E1_UFD E1_FCCH E1_4HB
Motif
Other DBs
NCBI-GeneID: 853670
NCBI-ProteinID: NP_012712
SGD: S000001693
UniProt: P22515
Structure
PDB: 

Position
XI:39163..42237
Genome map
AA seq 1024 aa AA seqDB search
MSSNNSGLSAAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGV
KSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQL
SQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEE
PRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI
GSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALH
QFAVRHNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIP
GVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQ
IAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLN
RQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVT
NALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLC
TLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVKGVLESISD
SLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEF
DIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQV
NDDDPDPNANAANGSDEIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNC
RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN
LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG
VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI
TIHL
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataatagtggtctctctgccgccggagaaatcgatgaaagtctttattct
cgtcaactttatgtgttgggtaaggaagcaatgttgaaaatgcaaacctccaacgtatta
attctcggcttgaaggggctaggtgttgagatagcgaagaacgttgtgttggcaggtgtc
aaatctatgaccgtttttgaccctgagccggttcaattggcagacttatcaacccaattc
tttttgaccgaaaaggatattggtcaaaagagaggagatgtgaccagagccaaattggca
gagttgaacgcatatgtcccggttaatgtgctggattccttagacgatgttacccaattg
agtcaattccaggtcgttgtcgctacggacactgtttctttggaagataaggtgaaaatc
aacgaattttgccattcctccggtattagattcatttcctcggagacaagagggctgttt
ggtaacaccttcgtagacctaggtgacgagttcacagtgttggacccaacgggtgaagaa
cctcgcactggtatggtttcagacatcgagcccgatggaacagtgaccatgctagatgat
aacagacacgggttggaagacggaaattttgtcaggttctccgaagtagaaggtcttgat
aagttgaatgatgggaccctttttaaagttgaggttttggggccctttgcattcagaatt
ggttcagtcaaagaatatggcgagtataagaagggcggtatcttcaccgaagtcaaagta
ccccgtaaaatctcattcaagtctttgaaacaacaactgtccaatcctgagtttgttttt
tcggattttgctaaatttgacagagctgctcaattgcatttgggatttcaggctttacat
cagtttgccgttagacataatggtgaactgccaagaacaatgaatgacgaagacgccaat
gaattaatcaagttggtcaccgatttgtccgttcagcaaccggaggttctgggtgaaggt
gtagatgttaatgaagatttaatcaaagagctttcctatcaggcaagaggtgacataccg
ggtgtcgtagcatttttcggtggccttgtggcacaagaagtgttaaaagcatgttctggt
aaatttactccgctaaagcaatttatgtactttgattccttggaatcattgccagatcct
aaaaacttcccaagaaatgagaagactactcagccagtaaactctcgttacgataatcaa
atcgcggttttcggtttggattttcagaaaaagattgccaattcaaaggtctttcttgtc
ggatctggtgccattggttgtgagatgttgaaaaattgggcacttttggggcttggttct
ggctccgacggttacatcgttgttacggataacgattcgatcgaaaagtccaacttaaac
cgtcagttcttgtttagaccaaaggatgtcggaaagaacaaatctgaagtagcggcagag
gccgtttgtgctatgaaccccgatttgaagggcaagataaatgctaaaattgataaagtg
gggccagaaactgaggaaatatttaatgactccttttgggaaagcctggattttgtcacc
aacgctctagacaatgtcgacgcaagaacatacgtagatcgccgttgtgtgttttataga
aaaccactgttagaatctggtaccctaggtactaaaggtaatactcaagtcatcattcca
agattgactgaatcatactcttcttctagagacccaccagaaaagtctatcccattgtgt
accctacgttctttcccaaacaagattgatcacaccattgcctgggccaaatctcttttc
caaggttacttcactgattccgccgaaaacgttaatatgtacttgacacaaccgaatttc
gttgagcaaacactaaagcaaagcggggatgtcaagggagttctagaatccatctcagat
tctctatctagtaaaccacacaattttgaagattgtatcaaatgggcaaggttagaattt
gaaaaaaaattcaaccatgatatcaagcagttactgttcaacttccccaaggatgccaag
acttccaacggtgaaccattttggtccggtgctaagcgtgctccaacaccattagagttt
gatatttacaataacgatcacttccattttgtcgtagcaggtgctagtttacgcgcttat
aattatggtattaaaagtgatgactctaattctaaacccaacgtggacgagtataagtcc
gtcatcgatcatatgataattccagaatttactccaaatgccaatttgaaaattcaagtt
aatgacgatgatccggatccaaatgccaacgcggctaatggctcagatgaaattgatcag
ctggtatcatccctaccagatccttctactttggctggctttaaactggagcctgtagat
ttcgagaaagacgatgacactaatcatcatattgaatttataacggcttgttctaactgt
agagctcaaaactacttcatcgaaactgctgatcgccaaaagaccaaattcatagctggc
cgtattattcctgccatcgcaacaaccacttctttggttactggtttggtcaatttggaa
ttatataaactgattgacaacaagacagatattgagcaatataagaatggctttgttaat
ttagctttgccatttttcggtttttcggaaccaattgcttcaccaaagggagaatataac
aacaagaaatatgataaaatttgggatagatttgatatcaagggagatattaaattaagt
gatttaattgaacattttgaaaaagatgaagggttagaaataacaatgctttcttatggc
gtttctcttctttatgcctcatttttccctccaaagaaattgaaagaaagactaaatcta
ccaataactcaattggttaaattagtgactaagaaagatattccggcacatgtatctaca
atgattctcgaaatttgcgcagatgacaaggaaggagaggatgttgaagttcctttcatt
accattcatctatga

DBGET integrated database retrieval system