KEGG   Saccharomyces cerevisiae (budding yeast): YKL213CHelp
Entry
YKL213C           CDS       T00005                                 

Gene name
DOA1, UFD3, ZZZ4
Definition
(RefSeq) Doa1p
  KO
K14018  phospholipase A-2-activating protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YKL213C (DOA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PUL PFU WD40 BBS2_Mid WD40_like ANAPC4_WD40 Proteasom_PSMB
Motif
Other DBs
NCBI-GeneID: 853667
NCBI-ProteinID: NP_012709
SGD: S000001696
UniProt: P36037
Structure
PDB: 

Position
XI:complement(31960..34107)
Genome map
AA seq 715 aa AA seqDB search
MGYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSV
CYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKT
AKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHND
VVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGED
RTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWASEDEI
NELSTQVEKSTISSKTIEFDESKLSPYEILQSPGRKEGQIVVVKSPQGTIEAHQFSNSSW
KKVGDVVGAGATGNDKKIEFEGKTYDYVFDVDIEDGKPPLKLPINVSDNPYTAADNFLAR
YELPMSYRDQVVQFILKNTNGISLDQPNDNASSSAVSPSKTSVMKVLPVKQYLIMENYNP
DTIFNGIVKINSNEKTFDDEILAQIGGALHDIDESWELLLSFANTIRSNWEIKTPAYDIV
RLIVKKLPYSSDIKDYIEEGLGNKNITLTMLTVRILVNCFNNENWGVKLLESNQVYKSIF
ETIDTEFSQASAKQSQNLAIAVSTLIFNYSALVTKGNSDLELLPIVADAINTKYGPLEEY
QECEEAAYRLTVAYGNLATVEPTLRQFANSVTWLANIKRSYGNVPRFKDIFDDLS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcaattgagtgcaacacttaaagggcacgatcaggacgtcagggatgtggta
gctgtggatgattcaaaggttgctagtgtttcgagggatggaacagttcgcttgtggtct
aaagatgaccaatggctcggtacggtagtttatacaggacaaggatttttaaatagtgtg
tgttatgattccgagaaggagttgttgctttttggaggtaaggatactatgatcaacggt
gtgcccttgtttgccacctcaggagaggatcccttgtataccttgattggccaccaaggg
aacgtttgtagtttatccttccaagatggtgttgtgataagcggtagttgggacaaaacc
gcaaaggtttggaaagaaggatcgttggtttacaatttgcaagcacacaatgcctctgta
tgggatgccaaagtcgtatccttctcagaaaataaattcttgacagcttccgccgataag
acgattaaactgtggcaaaacgataaagtgatcaaaactttcagtgggattcacaatgat
gtagtaagacatttagctgtggtggatgatggccattttatcagttgttcaaacgatggc
ctcatcaagttggttgatatgcatacaggtgacgtactaagaacatatgaaggccatgaa
agctttgtttattgcattaaactgctgcccaatggagatattgtaagctgcggcgaagac
cgaacagtccgtatatggtcaaaggaaaatggttcgttaaagcaggtaattacacttcct
gccatctctatttggtccgttgattgtatgtctaatggtgatattattgtgggaagtagt
gataatcttgtgagaatattttcgcaagagaagtcaagatgggcttccgaggatgaaata
aatgaactatctacgcaagtggaaaaatccactataagttccaagacaatagaatttgat
gagtctaaactatcaccttatgaaattttacaatcgccggggcgcaaagagggtcaaatt
gtggtagtcaaatcacctcaaggtactatagaagctcatcaattttcaaattcttcatgg
aaaaaggttggtgatgttgtcggtgcaggtgctactggaaacgacaaaaaaatagaattc
gagggtaaaacgtatgactacgtatttgatgtggatattgaagatggaaaacctcccttg
aaattgccgattaatgtcagcgacaacccatatacagcagccgacaattttttggctcgt
tatgaactgccaatgagttatagggatcaagtagtacagttcatactgaagaacactaat
ggcatatcgctagaccagcccaacgataatgcatcatcttctgcagtatcaccttcaaaa
acgagcgtaatgaaggttcttcctgtcaagcagtatcttatcatggaaaattataaccca
gatactattttcaatggaatagtaaaaataaattcaaatgagaagacctttgatgatgaa
attctggcgcaaattggtggcgcactacatgacatagatgaaagctgggagttgctactt
tcatttgctaacactataagatctaactgggaaattaagactcctgcatacgacatagta
cgattgattgtaaaaaaattaccttattcttcagatataaaagattacatcgaagaaggc
ttgggcaataagaatatcactctaaccatgttaactgtgcgtattttggtaaattgcttc
aataatgaaaactggggtgtgaaattactggaatcaaatcaagtttataaatcaattttt
gagactatagatactgaattttctcaggcatctgctaaacagtcacagaatttggctatt
gcagtttccacactaattttcaactattcagctctcgtcacgaaagggaactctgattta
gaacttttgcctatcgtagctgacgccatcaacaccaagtatgggccattggaagagtat
caagaatgcgaagaagccgcatataggctaaccgtagcttacggaaatttggctactgtt
gaacctacattaagacaatttgccaactccgtaacttggcttgcaaacatcaaaaggagc
tatgggaacgtgccaaggtttaaggatattttcgacgatctctcctaa

DBGET integrated database retrieval system