KEGG   Saccharomyces cerevisiae (budding yeast): YKL216WHelp
Entry
YKL216W           CDS       T00005                                 

Gene name
URA1
Definition
(RefSeq) dihydroorotate dehydrogenase
  KO
K00226  dihydroorotate dehydrogenase (fumarate) [EC:1.3.98.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00240  Pyrimidine metabolism
sce01100  Metabolic pathways
Module
sce_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YKL216W (URA1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.1  dihydroorotate dehydrogenase (fumarate)
     YKL216W (URA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHO_dh FMN_dh Polysacc_deac_1 DUF2059 Glu_synthase IMPDH
Motif
Other DBs
NCBI-GeneID: 853664
NCBI-ProteinID: NP_012706
SGD: S000001699
UniProt: P28272
Position
XI:25215..26159
Genome map
AA seq 314 aa AA seqDB search
MTASLTTKFLNNTYENPFMNASGVHCMTTQELDELANSKAGAFITKSATTLEREGNPEPR
YISVPLGSINSMGLPNEGIDYYLSYVLNRQKNYPDAPAIFFSVAGMSIDENLNLLRKIQD
SEFNGITELNLSCPNVPGKPQVAYDFDLTKETLEKVFAFFKKPLGVKLPPYFDFAHFDIM
AKILNEFPLAYVNSINSIGNGLFIDVEKESVVVKPKNGFGGIGGEYVKPTALANVRAFYT
RLRPEIKVIGTGGIKSGKDAFEHLLCGASMLQIGTELQKEGVKIFERIEKELKDIMEAKG
YTSIDQFRGKLNSI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacagccagtttaactaccaagttcttgaacaatacctatgaaaacccatttatgaat
gcatccggtgttcattgcatgactacacaagaattagatgaattagcaaactctaaagct
ggcgcattcattacaaagagtgctacaaccttagaaagagaaggtaaccctgaaccacgt
tacatttctgtccctctaggcagtatcaactccatgggtttaccaaacgaaggtatcgac
tactatttgtcctatgtattaaaccgtcaaaagaattatcctgatgcacctgctattttc
ttctcagttgctggtatgagcattgatgaaaatttaaatttgttgaggaaaatccaagat
agcgaattcaacggtattaccgagttaaacttgtcttgtcctaatgtgcctgggaaacca
caagttgcttatgactttgacttgacaaaggaaaccttggaaaaggtttttgcctttttc
aaaaaacctcttggtgtcaagttgcctccttattttgattttgcccattttgatatcatg
gcaaaaatattgaacgagttcccattagcttatgtcaactctatcaatagtataggaaat
ggtcttttcattgatgtggagaaggagagtgtagtagtgaagccaaagaatggtttcggg
ggtattggaggtgaatatgttaagccaaccgcgctcgccaatgttcgtgcattttacact
cgtttgagacctgaaatcaaagttatcggtacaggtggaattaagtccggtaaggatgca
tttgaacatcttctatgtggtgcctctatgctacagattggtacagaattacaaaaagag
ggcgtcaagatttttgaacgtatcgaaaaagaattaaaagacataatggaagctaagggt
tatacatccatagatcagttccgtgggaagttgaacagcatttaa

DBGET integrated database retrieval system