KEGG   Saccharomyces cerevisiae (budding yeast): YKL221W
Entry
YKL221W           CDS       T00005                                 

Symbol
MCH2
Name
(RefSeq) Mch2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 853659
NCBI-ProteinID: NP_012701
SGD: S000001704
UniProt: P36032
Position
XI:6107..7528
AA seq 473 aa
MSEERHEDHHRDVENKLNLNGKDDINGNTSISIEVPDGGYGWFILLAFILYNFSTWGANS
GYAIYLAHYLENNTFAGGSKLDYASIGGLAFSCGLFFAPVITWLYHIFSIQFIIGLGILF
QGAALLLAAFSVTLWEIYLTQGVLIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSG
LGGIVFNLGMQSILQKRGVKWALIAQCIICTSLSTIALMLTRTTHQGLRQHKRSYKFELL
DYDVLSNFAVWLLFGFVSFAMLGYVVLLYSLSDFTVSLGYTSKQGSYVSCMVSVGSLLGR
PIVGHIADKYGSLTVGMILHLVMAILCWAMWIPCKNLATAIAFGLLVGSIMGTIWPTIAS
IVTRIVGLQKLPGTFGSTWIFMAAFALVAPIIGLELRSTDTNGNDYYRTAIFVGFAYFGV
SLCQWLLRGFIIARDEIAVREAYSADQNELHLNVKLSHMSKCLFRYKQLPRRV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtccgaagaacggcatgaagatcatcatagggatgttgaaaataaattgaatttaaat
ggtaaagacgatattaacgggaatacctcaatctcgatcgaggtgcctgatggaggatat
gggtggtttattcttcttgcttttattctgtacaacttttctacttggggggcaaattct
ggttatgctatttatttagcgcattatttagagaataatacttttgctggtgggagtaaa
ttagactatgcttctataggtgggttagcattcagttgtggacttttttttgccccagtt
ataacatggctttatcatatattttcaattcaattcattataggcttagggatactgttt
caaggggcagcgctactgcttgcagctttttctgtcacactctgggaaatttatctcacg
caaggcgttttaattggattcggtttagcatttattttcatacccagtgtcacactcatc
ccactatggttcagaaataaaagatctttagcctctggtataggaactgctggaagcggg
ttaggtggtattgtctttaacttgggaatgcaaagtattctacaaaagaggggcgttaaa
tgggcgctcattgctcagtgcataatatgcacatcacttagcaccattgcgcttatgttg
accagaacaacacatcaaggcctacgtcaacataagagatcttacaaatttgaattgcta
gattatgatgtgctttcaaatttcgcggtctggttactttttggatttgtatcatttgct
atgttaggatatgttgtccttttgtattccttgtctgattttaccgttagtttaggttat
actagtaagcaaggctcatacgtatcgtgcatggtgagtgtcggctctctgctgggacga
ccaattgtgggtcacattgctgataaatatggatcactaacagttggcatgatattgcac
cttgtcatggccatcctttgttgggccatgtggataccttgtaaaaatttggccactgcg
atagcttttggattattggttggttctattatgggaacaatttggccaacaattgcttca
attgttacacgcattgttggtcttcaaaagcttcctggtacctttggtagtacctggatt
tttatggcggcttttgccttagttgcccccataatcggtctggaacttcgttcaactgat
acgaatggaaacgattattatcgtacagcaatattcgtgggttttgcgtactttggtgtt
agtttatgccaatggctattgagagggtttataatagctcgagatgagattgctgtgcgt
gaagcctattcagctgaccaaaatgaattgcatttaaacgttaagttatcacatatgagt
aaatgtctttttcgttataaacaattacctaggagagtctaa

DBGET integrated database retrieval system