KEGG   Saccharomyces cerevisiae (budding yeast): YKR001C
Entry
YKR001C           CDS       T00005                                 

Gene name
VPS1, GRD1, LAM1, SPO15, VPL1, VPT26
Definition
(RefSeq) dynamin-like GTPase VPS1
  KO
K23481  vacuolar protein sorting-associated protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKR001C (VPS1)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Others
   Others
    YKR001C (VPS1)
 Endosome - Golgi transport
    YKR001C (VPS1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1
Other DBs
NCBI-GeneID: 853870
NCBI-ProteinID: NP_012926
SGD: S000001709
UniProt: P21576
Position
XI:complement(440608..442722)
AA seq 704 aa
MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTG
IVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKE
EWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLP
GLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGT
RTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKF
FENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLGPET
MDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFD
QIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQ
IISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGSQA
MVMVEEKLHPRQVAVDPKTGKPLPTQPSSSKAPVMEEKSGFFGGFFSTKNKKKLAALESP
PPVLKATGQMTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVL
LEKLYGKQDIEELTKENDITIQRRKECKKMVEILRNASQIVSSV
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggatgagcatttaatttctactattaacaagcttcaggacgctttggcgcccttagga
ggaggatctcaatctcctattgatttaccacagatcactgttgtcggttcccagtcgtca
ggaaagtcgtccgttttggagaacattgttggtagggatttcttgccaagaggtactggt
attgtcaccaggagacctttagtgttacaattgattaataggagaccaaaaaagtcagaa
catgctaaagtaaaccaaactgctaatgaattgattgacttgaacatcaacgatgatgac
aagaaaaaggatgaatcaggaaagcaccagaacgagggacaatctgaagacaataaagag
gaatggggtgaatttttgcatttacctggtaagaagttttataattttgacgaaattaga
aaggaaatcgtcaaagaaactgacaaagtgacaggtgccaattcaggtatttcttctgtg
cccattaacttgagaatttattctccgcatgttcttactttgacgttagtggatttgcct
gggttgacgaaggttcccgtaggtgaccaacctcctgatattgaaagacaaattaaggac
atgttgttaaagtatatttcgaaaccaaacgctatcatattatctgttaatgccgctaac
accgatttagccaacagcgatggtttgaagctggctagagaggtcgatccagaaggaacg
agaactattggtgtcttgacaaaagtcgatttgatggatcaaggtacagatgtcatagat
attttggctggaagagtcattcctttgagatatggttatatcccagttatcaatagaggt
caaaaggatattgaacacaaaaaaacaatcagagaagcccttgaaaacgaaagaaaattt
tttgagaaccatccctcttacagttctaaagctcattactgtggtacaccatatttggct
aaaaagttaaactcaatcttattacaccacattaggcaaactctgccagaaatcaaagcg
aaaatcgaagccacattgaaaaaatatcaaaacgaacttataaacttgggcccagaaact
atggattcagctagttcggttgttttgagcatgattactgatttttccaatgaatatgcc
ggtatcttggacggtgaggcgaaggagctttccagtcaggaactttctggtggtgctaga
atttcttacgtattccatgaaactttcaaaaatggtgtagactctttggatccattcgac
cagatcaaagattctgatatcagaaccattatgtacaatagttcaggttctgccccatct
ttgtttgtcggtaccgaagcttttgaagttttagttaaacagcaaattagaagatttgaa
gaaccatctctacgtttagttactctggtgtttgatgaacttgttcgtatgctaaaacag
attatttcacaaccaaagtactcaaggtatcctgctctaagagaagcgatttctaatcag
ttcattcagttcttaaaggatgctactattcctacgaatgagtttgttgtcgatatcatc
aaagctgaacaaacttacatcaatacagcccatcccgaccttttgaagggttctcaagca
atggttatggtggaagaaaaattacatcctcgccaagtcgctgttgacccaaagacgggt
aaaccattaccaacccaaccatcgtctagtaaggcgccagttatggaagagaaatcagga
ttttttggtgggttcttctccactaaaaacaagaagaaattggcagctttggaatcccca
cctcctgttttaaaagctactggccaaatgacagagagggaaacaatggaaacagaagta
atcaagttgttgattagtagttatttctctattgtcaaaagaaccattgccgatattata
ccaaaggctttgatgcttaaattgattgtgaaaagtaaaactgatattcagaaagtttta
ctcgaaaaactttacggaaagcaagatattgaagaattaacgaaagaaaacgacataacc
attcaaagaagaaaagaatgtaagaagatggtcgagatattgagaaacgctagtcaaatc
gtctcctctgtttag

DBGET integrated database retrieval system