KEGG   Saccharomyces cerevisiae (budding yeast): YKR001CHelp
Entry
YKR001C           CDS       T00005                                 

Gene name
VPS1, GRD1, LAM1, SPO15, VPL1, VPT26
Definition
(RefSeq) dynamin-like GTPase VPS1
  KO
K17065  dynamin 1-like protein [EC:3.6.5.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YKR001C (VPS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKR001C (VPS1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YKR001C (VPS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKR001C (VPS1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     YKR001C (VPS1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    YKR001C (VPS1)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    YKR001C (VPS1)
   RhoA-dependent endocytosis
    YKR001C (VPS1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    YKR001C (VPS1)
   Retention of mitochondria
    YKR001C (VPS1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKR001C (VPS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 853870
NCBI-ProteinID: NP_012926
SGD: S000001709
UniProt: P21576
Position
XI:complement(440608..442722)
Genome map
AA seq 704 aa AA seqDB search
MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTG
IVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKE
EWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLP
GLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGT
RTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKF
FENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLGPET
MDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFD
QIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQ
IISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDLLKGSQA
MVMVEEKLHPRQVAVDPKTGKPLPTQPSSSKAPVMEEKSGFFGGFFSTKNKKKLAALESP
PPVLKATGQMTERETMETEVIKLLISSYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVL
LEKLYGKQDIEELTKENDITIQRRKECKKMVEILRNASQIVSSV
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcatttaatttctactattaacaagcttcaggacgctttggcgcccttagga
ggaggatctcaatctcctattgatttaccacagatcactgttgtcggttcccagtcgtca
ggaaagtcgtccgttttggagaacattgttggtagggatttcttgccaagaggtactggt
attgtcaccaggagacctttagtgttacaattgattaataggagaccaaaaaagtcagaa
catgctaaagtaaaccaaactgctaatgaattgattgacttgaacatcaacgatgatgac
aagaaaaaggatgaatcaggaaagcaccagaacgagggacaatctgaagacaataaagag
gaatggggtgaatttttgcatttacctggtaagaagttttataattttgacgaaattaga
aaggaaatcgtcaaagaaactgacaaagtgacaggtgccaattcaggtatttcttctgtg
cccattaacttgagaatttattctccgcatgttcttactttgacgttagtggatttgcct
gggttgacgaaggttcccgtaggtgaccaacctcctgatattgaaagacaaattaaggac
atgttgttaaagtatatttcgaaaccaaacgctatcatattatctgttaatgccgctaac
accgatttagccaacagcgatggtttgaagctggctagagaggtcgatccagaaggaacg
agaactattggtgtcttgacaaaagtcgatttgatggatcaaggtacagatgtcatagat
attttggctggaagagtcattcctttgagatatggttatatcccagttatcaatagaggt
caaaaggatattgaacacaaaaaaacaatcagagaagcccttgaaaacgaaagaaaattt
tttgagaaccatccctcttacagttctaaagctcattactgtggtacaccatatttggct
aaaaagttaaactcaatcttattacaccacattaggcaaactctgccagaaatcaaagcg
aaaatcgaagccacattgaaaaaatatcaaaacgaacttataaacttgggcccagaaact
atggattcagctagttcggttgttttgagcatgattactgatttttccaatgaatatgcc
ggtatcttggacggtgaggcgaaggagctttccagtcaggaactttctggtggtgctaga
atttcttacgtattccatgaaactttcaaaaatggtgtagactctttggatccattcgac
cagatcaaagattctgatatcagaaccattatgtacaatagttcaggttctgccccatct
ttgtttgtcggtaccgaagcttttgaagttttagttaaacagcaaattagaagatttgaa
gaaccatctctacgtttagttactctggtgtttgatgaacttgttcgtatgctaaaacag
attatttcacaaccaaagtactcaaggtatcctgctctaagagaagcgatttctaatcag
ttcattcagttcttaaaggatgctactattcctacgaatgagtttgttgtcgatatcatc
aaagctgaacaaacttacatcaatacagcccatcccgaccttttgaagggttctcaagca
atggttatggtggaagaaaaattacatcctcgccaagtcgctgttgacccaaagacgggt
aaaccattaccaacccaaccatcgtctagtaaggcgccagttatggaagagaaatcagga
ttttttggtgggttcttctccactaaaaacaagaagaaattggcagctttggaatcccca
cctcctgttttaaaagctactggccaaatgacagagagggaaacaatggaaacagaagta
atcaagttgttgattagtagttatttctctattgtcaaaagaaccattgccgatattata
ccaaaggctttgatgcttaaattgattgtgaaaagtaaaactgatattcagaaagtttta
ctcgaaaaactttacggaaagcaagatattgaagaattaacgaaagaaaacgacataacc
attcaaagaagaaaagaatgtaagaagatggtcgagatattgagaaacgctagtcaaatc
gtctcctctgtttag

DBGET integrated database retrieval system