KEGG   Saccharomyces cerevisiae (budding yeast): YKR002WHelp
Entry
YKR002W           CDS       T00005                                 

Gene name
PAP1
Definition
(RefSeq) polynucleotide adenylyltransferase PAP1
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YKR002W (PAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKR002W (PAP1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     YKR002W (PAP1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     YKR002W (PAP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Polbeta
Motif
Other DBs
NCBI-GeneID: 853871
NCBI-ProteinID: NP_012927
SGD: S000001710
UniProt: P29468
Structure
PDB: 

Position
XI:443232..444938
Genome map
AA seq 568 aa AA seqDB search
MSSQKVFGITGPVSTVGATAAENKLNDSLIQELKKEGSFETEQETANRVQVLKILQELAQ
RFVYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDIDTLVVVPKHVTREDFFTVF
DSLLRERKELDEIAPVPDAFVPIIKIKFSGISIDLICARLDQPQVPLSLTLSDKNLLRNL
DEKDLRALNGTRVTDEILELVPKPNVFRIALRAIKLWAQRRAVYANIFGFPGGVAWAMLV
ARICQLYPNACSAVILNRFFIILSEWNWPQPVILKPIEDGPLQVRVWNPKIYAQDRSHRM
PVITPAYPSMCATHNITESTKKVILQEFVRGVQITNDIFSNKKSWANLFEKNDFFFRYKF
YLEITAYTRGSDEQHLKWSGLVESKVRLLVMKLEVLAGIKIAHPFTKPFESSYCCPTEDD
YEMIQDKYGSHKTETALNALKLVTDENKEEESIKDAPKAYLSTMYIGLDFNIENKKEKVD
IHIPCTEFVNLCRSFNEDYGDHKVFNLALRFVKGYDLPDEVFDENEKRPSKKSKRKNLDA
RHETVKRSKSDAASGDNINGTTAAVDVN
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcaaaaggtttttggtattactggacctgtttccaccgtgggcgccacagca
gcagaaaataaattaaatgatagtttaatccaagaactgaaaaaggaaggatcgttcgaa
acagagcaagaaactgccaatagggtacaagtgttgaaaatattgcaggaattggcacaa
agatttgtttatgaagtatcgaagaagaaaaatatgtcagacgggatggcaagggatgct
ggtgggaagatttttacgtatgggtcctatagactaggagtccatgggcctggtagtgat
atcgatactttggtagttgttccaaaacatgtaactcgggaagatttttttacggtattt
gattcactactgagagagaggaaggaactggatgaaattgcacctgtacctgatgcgttt
gtcccgattatcaagataaagttcagtggtatttctatcgatttaatctgtgcacgtcta
gaccaacctcaagtgcctttatccttgactttatcagataaaaatctactgcgaaatcta
gacgagaaggacttgagagctttgaatggtaccagagtaacagatgagatattagaactg
gtaccaaagccgaatgttttcagaatcgctttaagagctattaagctatgggcccaaaga
agggctgtttatgctaatatttttggttttcctggtggtgtggcttgggccatgctagtg
gctagaatttgtcaactataccctaacgcctgtagcgcagttatattgaacagatttttc
atcattttgtcggaatggaattggccacaacctgttatcttgaaaccaattgaggatggc
ccgttacaagttcgtgtatggaatccaaagatatatgcccaagacaggtctcatagaatg
cccgtcattacaccagcttatccatcaatgtgtgctacccataacatcacggaatctact
aaaaaagtcattttacaggaattcgtaagaggcgttcaaattacgaatgatattttttcc
aataagaagtcctgggccaatttattcgaaaaaaacgattttttctttcgatacaagttc
tatttagaaattactgcatatacaaggggcagtgacgagcagcatttaaaatggagtggt
cttgttgaaagtaaggtaaggcttctagttatgaaactggaggtgttagctggaataaaa
attgcacatcctttcaccaaaccctttgaaagtagttattgttgtccaaccgaggatgac
tatgaaatgattcaagacaaatacggtagtcataaaactgagacagcactgaacgccctt
aaactggtaacagatgaaaataaagaggaagaaagtattaaagatgcaccaaaggcatat
ttaagcaccatgtacataggccttgactttaatattgaaaacaaaaaggaaaaagttgac
attcacattccctgcactgaatttgtgaatttatgtcgaagtttcaatgaggattatggt
gaccacaaagtattcaatctagccctccgcttcgtaaagggttacgatttgccagatgaa
gttttcgatgaaaatgaaaagagaccatcaaagaagagtaaaaggaagaatttagatgct
agacatgaaaccgtgaagagatctaaatcagatgctgcttcaggtgacaacatcaatggc
acaaccgcagctgttgacgtaaactaa

DBGET integrated database retrieval system