KEGG   Saccharomyces cerevisiae (budding yeast): YKR003WHelp
Entry
YKR003W           CDS       T00005                                 

Gene name
OSH6
Definition
(RefSeq) oxysterol-binding protein OSH6
  KO
K22285  oxysterol-binding protein-related protein 8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKR003W (OSH6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YKR003W (OSH6)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    YKR003W (OSH6)
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YKR003W (OSH6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxysterol_BP
Motif
Other DBs
NCBI-GeneID: 853872
NCBI-ProteinID: NP_012928
SGD: S000001711
UniProt: Q02201
Structure
PDB: 

Position
XI:445381..446727
Genome map
AA seq 448 aa AA seqDB search
MGSKKLTVGSDSHRLSKSSFSSNKSSHSATKDQPIDTDDIDEDDESGHNIILNIISQLRP
GCDLTRITLPTFILEKKSMLERVTNQLQFPEFLLQAHSEKDPLKRFLYVMKWYLAGWHIA
PKAVKKPLNPVLGEYFTAYWDLPNKQQAYYISEQTSHHPPECAYFYMIPESSIRVDGVVI
PKSRFLGNSSAAMMDGSTVLQFLDIKDGNGKPEKYVLTQPNVYVRGILFGKMRIELGDHM
IIKSPNFQADIEFKTKGYVFGTYDAIEGTVKDYDGNAYYEISGKWNDVMYLKDLKQPRSS
PKVFLDTHKESPLRPKVRPLSEQGEYESRKLWKKVTDALAVRNHPVATEEKFQIEDHQRQ
LAKKRIEDGVEFHPKLFRRSKPGEDLDYCIYKNIPVDEDPEKQIRSILQIAPILPGQQFT
DKFFIPAFEKIKSQKKMIENEKQNPAKQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggctccaaaaaactgaccgtaggatctgattcgcaccggttgagcaaatccagtttt
tcaagtaataagtcgtcacattcagcaacaaaagatcagccaattgataccgacgatatt
gatgaagacgatgaatctggtcataatattatcttgaacatcatctcacaattgagacca
ggctgcgatttgaccaggatcaccttgcctacttttattttagaaaaaaaatcgatgctt
gaacgtgtcacaaatcagttacaattccctgagtttttgttacaggcgcattcagaaaag
gaccccttgaaaagatttttgtacgtaatgaaatggtatttggcaggctggcatattgct
ccaaaggctgtaaaaaaaccattgaacccagtccttggtgaatattttacagcttattgg
gatctaccaaacaagcagcaggcatattatatatctgaacagacaagtcaccatcctcca
gaatgtgcatatttttacatgattcctgaatcttcgattagagtggatggggtcgttatt
cctaaatctagatttttaggtaattcaagtgcggccatgatggatggatcaacagtcttg
caatttctggacataaaggatggaaacggaaagcccgaaaagtatgttcttacacaacca
aatgtatatgtaagaggaattctttttggaaaaatgagaatcgaacttggagatcatatg
ataattaaatctcctaacttccaagctgatatagagttcaagacaaagggatatgttttt
ggaacttacgatgcaatcgaagggactgtaaaggattatgatggcaatgcgtattacgaa
atatctggtaaatggaatgacgttatgtatttaaaggacttaaagcaacctcgttcttca
ccaaaagttttccttgatactcataaagagtcaccattgagaccaaaagttcggccattg
agcgagcaaggtgaatatgaatccagaaaactgtggaaaaaggttacagatgcgttggcc
gttcgcaatcatcctgttgcgacagaagaaaaatttcagattgaagatcaccaaagacag
ttagccaaaaaacgcattgaagatggcgtagaatttcatccaaagttgtttagaagatca
aagcctggcgaagatcttgactattgtatttataaaaatatccctgtcgacgaggaccct
gagaagcaaatacgaagcatattgcaaatagcacctattttacctggtcaacaatttacc
gacaaatttttcatccccgcatttgagaaaataaaatcacaaaagaagatgattgaaaac
gaaaagcagaacccagcaaaacaatag

DBGET integrated database retrieval system