KEGG   Saccharomyces cerevisiae (budding yeast): YKR006CHelp
Entry
YKR006C           CDS       T00005                                 

Gene name
MRPL13, YK105
Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL13
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L50
Motif
Other DBs
NCBI-GeneID: 853875
NCBI-ProteinID: NP_012931
SGD: S000001714
UniProt: Q02204
Position
XI:complement(450423..451217)
Genome map
AA seq 264 aa AA seqDB search
MSSLLKLHCIRPLPQRSVWLSGYKQKARCIHSSAANGDFMSWFKRKKQEEHQEPVKDTKQ
LIKDIEEGTNEASSQSSSNNKNRLELIPENFIGEGSRRCKRQKELKLAVSSAPFNQWLSR
DKITSDNQLDDMILQATEKTLGKVDQDVQFSDLVAKFQFTKFLQSKSGYLIPDYELTTLS
TPLQFKRYIKEKILPSANDPKLAYKEAEPNAIHPFSDNYASPNIYVVNDVTSKEQKSKYD
TIMKEIQKLEDDATRKALETARSA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactgcttaaattacattgtattagaccattgccgcaaaggtcggtctggctc
tctggctacaagcagaaagccagatgtattcacagttccgctgcaaacggggactttatg
tcatggttcaagaggaagaagcaagaagagcaccaagagcctgtcaaggacaccaaacag
ttgataaaggatattgaagaaggcactaacgaggcttcctctcaatcctcttccaataac
aaaaacagattggagctaataccagaaaattttattggcgaagggtctagacggtgtaag
agacagaaggagttgaagcttgcggtctcctctgcgccattcaatcagtggttatccagg
gataagattacgtctgataatcagttagatgatatgatattgcaggcaacggaaaaaaca
ttgggcaaagtagaccaggacgtccaattctctgatttggtagctaaatttcagttcacc
aaatttttgcaatctaaatctggctatctaattcctgattatgaactgaccactttaagc
acacccttgcagtttaaaaggtatattaaggaaaaaattttgccatctgccaacgatcct
aaactcgcttataaagaagctgagccaaatgctatccacccattttctgataattacgcg
tcaccaaacatatatgttgttaacgatgttacttctaaagagcaaaaaagtaaatatgat
actattatgaaagaaattcaaaagttagaggatgatgcaacaagaaaagctttggaaaca
gcaagatccgcttag

DBGET integrated database retrieval system