KEGG   Saccharomyces cerevisiae (budding yeast): YKR007WHelp
Entry
YKR007W           CDS       T00005                                 

Gene name
MEH1, EGO1, GSE2
Definition
(RefSeq) Meh1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAMTOR
Motif
Other DBs
NCBI-GeneID: 853876
NCBI-ProteinID: NP_012932
SGD: S000001715
UniProt: Q02205
Structure
PDB: 

Position
XI:451434..451988
Genome map
AA seq 184 aa AA seqDB search
MGAVLSCCRNHSGEENEALLREQQAGYGSQGNANDEYDAEQMRLKEHEHEQKLLAREQEL
RDIVANTNDKLIDISMINNSGIVIQGTDLQEALDKRQQEEGGDSREDERSAGDDNLSGHS
VPSSGSAQATTHQTAPRTNTFTLLTSPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPL
TVPF
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgggagccgtactcagctgttgtagaaaccattccggcgaagagaatgaagctttgctg
agggaacagcaggcaggctatggaagtcaaggaaacgcaaatgacgaatacgatgccgaa
caaatgcggttgaaggaacacgaacacgaacagaaactgctggccagggaacaagagtta
agagacattgttgcaaacaccaacgataaactaatagacatatcgatgataaacaatagt
ggcattgtaattcaagggacagacctgcaagaagctcttgataaaagacaacaggaagaa
ggtggagattcccgggaagacgaaaggagtgcaggtgatgacaacctcagtgggcactca
gtgccttcaagcggatccgcacaggcaactactcaccaaactgcaccaaggactaatacg
tttactctgcttacatcaccggattcagcgaaaatatcaaaggaacagttaaagaagttg
cactctaatatactaaatgaaattttcagccagtcccaggtaaacaaaccaggccccttg
acggttcccttttaa

DBGET integrated database retrieval system