KEGG   Saccharomyces cerevisiae (budding yeast): YKR008WHelp
Entry
YKR008W           CDS       T00005                                 

Gene name
RSC4
Definition
(RefSeq) Rsc4p
  KO
K11759  chromatin structure-remodeling complex subunit RSC4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YKR008W (RSC4)
   03036 Chromosome and associated proteins [BR:sce03036]
    YKR008W (RSC4)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    RSC complex
     YKR008W (RSC4)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Chromatin remodeling factors
   RSC complex
    YKR008W (RSC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bromodomain
Motif
Other DBs
NCBI-GeneID: 853877
NCBI-ProteinID: NP_012933
SGD: S000001716
UniProt: Q02206
Structure
PDB: 

Position
XI:452201..454078
Genome map
AA seq 625 aa AA seqDB search
MVVKKRKLATEAGGSDERPKYLPGKHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNR
FISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFL
LDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLN
KLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQ
NLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDL
NERGEINLEFDKFEFENYLAIGGGGPAAAGALAISALDNDIEPESNREDLIDQADYDFNH
FEGLGNGYNRSLLTEDYLLNPNNFKKLIAKPETVQSEVKNERSTTSDIEKTNSLESEHLK
IPKYNVIKSMQKEMQSLSEQHTMEYKPYKLIQQIYIFSSKNLYSQATKPLLGSRPSCNQN
WVEYIFNGNELSQNENAFSFMLQPMQTFLTLQSHLTSSLKDTETLLTINKEPVKSRTSNV
NSNLSQPQQQENDVIGNDTKQDIENLTIGGGNNNDIVGNDNDKRNNITEIFDIRLSEGLN
HLMFRCEDKISHETEFMNFWINVLP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggtagttaagaagcgtaagttggcaactgaggccggtggcagtgatgaaaggcctaaa
tacttgccgggaaaacatcctaaaaaccaagagaaaactccgcatgtggattataacgcc
ccattaaaccctaaatctgaactttttctagatgactggcatatacctaaatttaatcga
tttattagtttcactttggatgttcttatcgacaaatacaaagatattttcaaagatttc
atcaaactaccaagtaggaagtttcatccacagtattattacaagatccagcagccaatg
tctattaatgaaatcaagtcaagagattatgaatacgaagatggtccaagtaattttctt
ttggatgttgagctactgacaaagaattgtcaagcttacaatgaatatgacagtttgatt
gtaaaaaactccatgcaagtagtaatgttgattgaatttgaagtattgaaggcaaaaaat
ttgaaaagaaattacttaattaacagcgaggtcaaagccaaattactgcactatcttaat
aagctagttgacgccacggaaaagaaaatcaaccaggctctgctgggtgcgtcatctcct
aaaaacttagacgacaaagtcaagctaagtgaaccgtttatggaattagtcgataaagat
gaacttcctgaatattatgaaatagtgcatagccccatggctttatcgatcgtaaagcag
aacctcgaaattggtcagtattccaagatatatgatttcatcattgatatgcttttagtt
tttcagaatgctcatatattcaatgatccaagcgctttgatttacaaagacgcaacaact
ttaacaaattattttaactacttaatacaaaaggaattcttcccagagttacaggattta
aatgaacgtggcgaaattaatttagaatttgacaaattcgaattcgaaaactacttagct
attggtggtggtggtccagccgcagcaggtgcgttagctatatctgctcttgataatgat
attgagccagaatctaaccgtgaagatcttattgatcaagcagattatgatttcaatcat
ttcgaaggtctcggcaatggttataatcgttctctcctaactgaagattatttactgaac
ccaaacaacttcaaaaagttaatagccaaaccggaaacagtgcaatccgaagtcaaaaat
gaaagatcaacgacatctgatattgagaagacaaactccttagagagcgaacatttaaaa
atccccaaatacaatgttataaaatccatgcaaaaagaaatgcaatcactctcagagcaa
cacaccatggagtataagccctataaattaatacaacaaatttacattttttcttctaaa
aatttgtattcgcaggcaactaagcctttactgggttcaaggccatcatgcaatcaaaat
tgggtagagtatattttcaatggtaatgaattgagtcaaaatgaaaacgctttctccttc
atgttacaacccatgcaaacttttttaacattacagtctcatttgacctcatcattaaag
gatacagagactttattaaccattaataaagagccagtgaagtctagaacttcaaatgta
aacagtaacctttcccaacctcagcaacaagaaaatgatgttattggaaacgatacgaag
caagatatagaaaatttgacaatcggcggcggcaacaataacgatattgttggtaacgat
aatgataaacgtaataatataaccgaaatctttgatattcgcttatcagaaggtttaaat
catttgatgtttaggtgtgaggacaaaatatctcatgaaacggaattcatgaatttctgg
ataaatgtcttaccatga

DBGET integrated database retrieval system