KEGG   Saccharomyces cerevisiae (budding yeast): YKR010CHelp
Entry
YKR010C           CDS       T00005                                 

Gene name
TOF2
Definition
(RefSeq) Tof2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytokin_check_N
Motif
Other DBs
NCBI-GeneID: 853880
NCBI-ProteinID: NP_012935
SGD: S000001718
UniProt: Q02208
Structure
PDB: 

Position
XI:complement(458924..461239)
Genome map
AA seq 771 aa AA seqDB search
MIKMWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITHNNSINNCSDPSPTS
PSSQNSIQSNRSSDFINYLPNCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIV
SLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRRRQDNKPST
KSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILPLASKYDA
LNKEKCPMPLTSTVVASNVHKDVKDHARAKEGVVTQGSDNNKENIPSSTQQQKNDGAKRA
ESKDLDLLRNSSEDADYEPADENSPQISFDSIDTDFQLSTTSHTNSDMHIQYSNPSSGAH
SPRKSSLEIKVQNKKGDDLPLNDKDIGENCRRIEAFSDEEDFNETDNDRADSFINNSKKA
SMGFRDINSDLDSVSFNSDIENAVQSTQSTKNVVSPPFFPEKELNNRLHQSQGKEALFRL
VEKEFPDKSLGAASSTSHAKDVKIQETIRKLNRFKPTGETKVQKRNSITEPYYGKFGIMK
KDKPKSITSKGVSLETKHFDDPNTIISGEKFAKFGKIKVKRKTDDVGSKVIEFKRKRNMG
NRSLKDIFANAGKPPNAASTIKVVKLMRDPVDNSKDKVEATSNSTAQEQEQVSPKLPVMN
STPGKRKNGQAIPSSLERTPQLKKVKVTRSHSSPSSSSSMSLESSLDSSSSDDSDDDSDS
RNVQVKKINFKTSHGPAGNSNGKPMLDVDDNEINTKKYQTPKYVESDEDDQ
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaatgtggaggttacagattgtactggtgccgccaagtgctcaagatattatc
acatttctcgaagcacgcttgaatactccacaatcagtgtctcctatggtccagtataat
gaagatataattacgcacaacaacagtatcaataactgtagcgacccctctcctacgagc
ccgtcttcgcaaaattctattcagtcgaatcgtagtagtgatttcattaactacctcccg
aattgtaaaaagtttttacattttacggacggtgacaatacccttttacaactatctaat
gaaattttaactaaatttgatagactttatccaaatttcaaagaatccattgaaatcgta
tctctacaagataggcatggttgtgatttggactctgaatttataataaaagacgtattt
gaaaatgatggtgtggttttggtaattttaaaagatgaattagactggagtagaaatcaa
catatttcacttttacaattggcaagacagcggagacggcaggacaacaagccatccaca
aaatccatcgttactgaaaagagaaaaaagatctctaaggaagacttatcttctatatca
aataaagatacaatgcatctaatagctaaaagctcgctcaagaataacttcattaataaa
tcaagagtatcaacgccgctaatgaacgaaattctaccgcttgcaagcaagtatgatgca
ctgaataaagaaaagtgtcccatgccacttacttccacagtagtggcatcaaatgtacac
aaagacgtaaaagatcacgctcgtgctaaagagggagttgtaacgcaagggagtgataac
aataaagaaaatataccttcatccactcaacaacagaaaaatgatggcgctaaaagggcc
gaatcaaaggatttagatcttttacgcaattcgtcagaagatgctgattatgaacccgca
gatgaaaactcccctcaaatttcgtttgattcgattgataccgacttccaattgagcact
acttctcatactaattctgatatgcatatacaatattctaacccctctagtggtgctcat
agtcccaggaagagttccttagaaattaaagttcaaaacaaaaaaggtgatgatctgcca
ttgaacgacaaagatataggtgagaattgtagaaggatagaagcattttcagatgaagag
gattttaatgaaaccgataatgatcgtgcggattcgtttatcaacaattctaagaaggca
tcgatgggatttcgggatatcaattccgacttggatagcgtttcattcaacagtgatatt
gaaaatgcagtacaaagtactcaaagtaccaaaaatgttgtttctcctcccttttttcct
gaaaaagaattgaataatcggttacatcaaagtcaaggtaaggaagccctatttcgactt
gttgagaaggagtttcctgataaatcattgggtgctgcgtcatctacttcgcatgcaaaa
gacgtaaaaatacaagaaactattcggaaactaaataggttcaagccaactggggaaact
aaggtccaaaaaaggaatagtattacggaaccatattacggaaaatttggaataatgaag
aaagataaacccaaatccataacttcaaaaggggtaagtctggaaacaaagcactttgat
gatcccaataccattatttccggtgagaaattcgcaaaatttggtaaaataaaagtgaaa
cgaaaaactgatgatgttggatcgaaagttatagagtttaaaagaaaaagaaatatgggg
aatagatccctaaaagatatttttgccaatgctgggaaaccgccaaatgcagcttcgacc
ataaaagtagtcaaattaatgagagatcctgttgataatagtaaagacaaagtggaggca
acttctaatagtacggctcaggaacaagaacaagtctcacccaagttgccagttatgaat
tcaactcctggaaaaagaaaaaatggccaagcgataccgtccagtttagaaagaacaccg
cagctcaagaaagtcaaggttaccaggtcgcattcttcaccttcttcttcttcttccatg
tcacttgaatcttcattggatagctcttcctcagatgattcggatgatgattctgattcg
aggaacgtgcaagttaaaaaaattaatttcaaaacaagtcatggaccagctggaaattct
aatggaaaaccaatgctggatgtggatgacaatgaaataaatacaaagaagtaccaaaca
cctaaatatgttgaaagtgatgaagacgaccagtaa

DBGET integrated database retrieval system