KEGG   Saccharomyces cerevisiae (budding yeast): YKR014CHelp
Entry
YKR014C           CDS       T00005                                 

Gene name
YPT52
Definition
(RefSeq) Rab family GTPase YPT52
  KO
K07889  Ras-related protein Rab-5C
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YKR014C (YPT52)
   04145 Phagosome
    YKR014C (YPT52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YKR014C (YPT52)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKR014C (YPT52)
   04031 GTP-binding proteins [BR:sce04031]
    YKR014C (YPT52)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    YKR014C (YPT52)
 Endosome - Lysosome transport
    YKR014C (YPT52)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKR014C (YPT52)
  Exosomal proteins of other body fluids (saliva and urine)
   YKR014C (YPT52)
  Exosomal proteins of colorectal cancer cells
   YKR014C (YPT52)
  Exosomal proteins of bladder cancer cells
   YKR014C (YPT52)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    YKR014C (YPT52)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase TniB Raptor_N AAA_16 IF3_N
Motif
Other DBs
NCBI-GeneID: 853884
NCBI-ProteinID: NP_012939
SGD: S000001722
UniProt: P36018
Position
XI:complement(465367..466071)
Genome map
AA seq 234 aa AA seqDB search
MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI
KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI
YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE
GVKEIFQDIGEKLYDLKKDEILSKQNRQIGGGNNGQVDINLQRPSTNDPTSCCS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaatttaaactagttttattgggtgactcatccgtgggtaaatcttccattgtt
catcgttttgttaaggatacattcgatgaactacgtgaaagtacgattggtgctgctttt
ttatctcaatcaatcactattcacccaaacgatggtaatgaaacaaaggatgtcgttata
aaatttgaaatctgggatactgctggtcaagaaagatacaagtcattggcaccaatgtat
tatagaaacgctaatgcagcattagttgtttatgacattacgcaggaagattcactacaa
aaggcaaggaactgggttgatgagctgaaaaataaggtaggcgacgacgacttggttatt
tatttactgggaaacaaagtggatttatgtcaagaaacgcctagcactgagacaagccca
gattcaaacgaaggtggagatgaagaacaaaaagtaagagcaattagcactgaagaagcg
aaacagtacgcacaagaacaagggttgctgttccgagaagttagtgctaagacaggtgaa
ggggttaaggaaatttttcaagatattggtgaaaaattatacgatttaaagaaagacgaa
attctctctaagcaaaatagacaaatcggtggaggcaataacggacaagtagacattaat
ttgcaaaggccatccacaaatgatccaacatcttgttgcagttga

DBGET integrated database retrieval system